DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and wwp2

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:XP_005163228.1 Gene:wwp2 / 564527 ZFINID:ZDB-GENE-000607-82 Length:867 Species:Danio rerio


Alignment Length:518 Identity:137/518 - (26%)
Similarity:222/518 - (42%) Gaps:102/518 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   591 LAAASPSAERRQQLLPYNTELEIILKLMKTLCQINNERHDRLNYQIFY---------WPDLSDYA 646
            |.|..|..|:||.                             |.:::|         |.|.....
Zfish   400 LGALPPGWEKRQD-----------------------------NGRVYYVNHNTRTTQWEDPRTQG 435

  Fly   647 DVQQEYVK--WIMADTARDFNICNYSFIFDQSAKTALLQADQALQMHSAMANAATMA-------- 701
            .:|:..:.  |.|..||.     ...:..|.:::|...: |......|......:..        
Zfish   436 MIQEPPLPPGWEMKYTAE-----GVRYFVDHNSRTTTFK-DPRPGFESGSRQGGSPGAYDRSFRW 494

  Fly   702 ----FSFFNYGMPISQFIVLNVTRENLVQDSLRELQHYSQSDLKKPLKIKFHGEEAEDAGGVRKE 762
                |.|..:...:...:.::|:|:.|.:||.:::.:....||::.|.|...|||..|.||:.:|
Zfish   495 KYHQFRFLCHSNALPSHVKISVSRQTLFEDSFQQIMNMKPYDLRRRLYIIMRGEEGLDYGGIARE 559

  Fly   763 FFMLLLKDLLDPKYGMFKEYEQSRLLWFADLTFETENMYFL------------------IGVLCG 809
            :|.||..::|:|.|.:|:              :..:|.|.|                  ||....
Zfish   560 WFFLLSHEVLNPMYCLFE--------------YAGKNNYCLQINPASSINPDHLTYFRFIGRFIA 610

  Fly   810 LAIYNFTIINLPFPLALFKKLLGKPVDLSDLRQLSPPEANSMQSLLDYQGDDFKEV-FDLTFEIS 873
            :|:|:...|:..|.|..:|::|.|...|.||..:.|...||:..:.:   :|.:|. .:|.|...
Zfish   611 MALYHGKFIDTGFTLPFYKRMLNKKPTLKDLESIDPEFYNSIMWVKE---NDLEECGVELYFAQD 672

  Fly   874 RDVFGEAETKCLKPNGNEIAVTLENRQEFVDLYVDFVFNKSVELHYNAFHKGFMKVCSGRVIHIF 938
            .::.|:..|..||.:|....||.:|::|::.|..|:.|.:.||....||..||.:|.....:..|
Zfish   673 MEILGKVTTHQLKDDGENELVTQDNKEEYIGLLTDWRFTRGVEEQTKAFLDGFNEVVPLEWLRYF 737

  Fly   939 QPEELMAVVVGNEDYDWQALQDNCEYREGYTSVDDTIKWFWEVIHDMSEAEKKSFLLFLTGSDRI 1003
            ..:||..::.|.::.|....|.|..||. ||.....|.|||:|:.:|...::...|.|:||:.|:
Zfish   738 DEKELELMLCGMQEIDLNDWQKNTIYRH-YTKNSKQIHWFWQVVKEMDNEKRIRLLQFVTGTCRL 801

  Fly  1004 PIQGMKAL-------KLTIQPTPDERFLPVAHTCFNLLDLPRYKTKERLKYKLLQAIQQTQGF 1059
            |:.|...|       |..|.....|.:||.:|||||.||||.||..|:|:.|||.||::|:||
Zfish   802 PVGGFAELIGSNGPQKFCIDKVGKETWLPRSHTCFNRLDLPPYKNLEQLREKLLFAIEETEGF 864

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033 116/371 (31%)
HECTc 739..1059 CDD:214523 109/345 (32%)
wwp2XP_005163228.1 C2_E3_ubiquitin_ligase 17..145 CDD:175988
WW 298..327 CDD:197736
WW 328..357 CDD:278809
WW 403..431 CDD:278809 7/56 (13%)
WW 441..473 CDD:197736 7/37 (19%)
HECTc 513..865 CDD:238033 116/370 (31%)
HECTc 536..864 CDD:214523 109/345 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.