DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and magi2a

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:NP_001314782.1 Gene:magi2a / 564112 ZFINID:ZDB-GENE-050810-4 Length:1503 Species:Danio rerio


Alignment Length:223 Identity:46/223 - (20%)
Similarity:70/223 - (31%) Gaps:101/223 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 GSSGQLGTR---STKSLMLPQVVIGPWVSP------SGSALLQSNDSQVS-LVIRQIFSGGDQSI 389
            |.||.||..   ..::...|  |||. |.|      ....||:.||:.|: |.||.:::      
Zfish    33 GPSGDLGFELQGGAENGQFP--VIGE-VKPDRRKLQQDELLLEVNDTPVAGLTIRDVWA------ 88

  Fly   390 VTTTLFVDKVPPEDFRNYNPKSQILTLTAEVTKQCA-----QC-KQGLQSDMDLLSSIELIFRSQ 448
                                          |.:.|.     :| |||...|.||...:.|.|:  
Zfish    89 ------------------------------VVRHCKDPVRFKCVKQGGVVDKDLRQYLNLRFQ-- 121

  Fly   449 ACWNGSFLLDHDRHFGCSVRNHGLDLKAAQLAFDNLRAVENESIRQVIWDNITKELVGSLVCSPA 513
               .||  |||:                               ::|:|.||:....|......|.
Zfish   122 ---KGS--LDHE-------------------------------LQQIIRDNLYLRTVPCTTRQPR 150

  Fly   514 DVESMRLYLLLP-LYHEFVNSKHYKSLQ 540
            :.|       :| :.:.||..:.:..|:
Zfish   151 EGE-------VPGVDYNFVTVERFVELE 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274 2/3 (67%)
RCC1 327..390 CDD:278826 19/64 (30%)
HECTc 715..1060 CDD:238033
HECTc 739..1059 CDD:214523
magi2aNP_001314782.1 PDZ_signaling 25..100 CDD:238492 21/105 (20%)
NK 122..286 CDD:302627 16/90 (18%)
WW 307..337 CDD:238122
WW 352..381 CDD:278809
PDZ 431..511 CDD:214570
PDZ 595..676 CDD:214570
PDZ 762..856 CDD:214570
PDZ_signaling 920..1007 CDD:238492
PDZ_signaling 1182..1262 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.