DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and hecw1b

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:XP_021336549.1 Gene:hecw1b / 563730 ZFINID:ZDB-GENE-060503-2 Length:1555 Species:Danio rerio


Alignment Length:371 Identity:117/371 - (31%)
Similarity:185/371 - (49%) Gaps:39/371 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   715 IVLNVTRENLVQDSLRELQHYSQSDLKK-PLKIKFHGEEAEDAGGVRKEFFMLLLKDLLDPKYGM 778
            |.|.|.|::|::.:..::..||:.:|:: .|.|.|.|||..|..|..:|||.||.::|.:|.||:
Zfish  1199 IKLIVRRDHLLEGTFNQVMAYSRKELQRNKLYITFVGEEGLDYSGPSREFFFLLSQELFNPYYGL 1263

  Fly   779 FKEYE----------------QSRLLWFADLTFETENMYFLIGVLCGLAIYNFTIINLPFPLALF 827
            | ||.                ::.|.||.           ..|.:.|||:.:..:::..|....:
Zfish  1264 F-EYSANDTYTVQISPMSAFVENHLEWFR-----------FSGRILGLALIHQYLLDAFFTRPFY 1316

  Fly   828 KKLLGKPVDLSDLRQLSPPEANSMQSLLDYQGDDFKEVFDLTFEISRDVFGEAETKCLKPNGNEI 892
            |.||..|.|||||..|......|:|.:.:   :|..:|.||||.::.:|||:...:.||..|..:
Zfish  1317 KALLRLPTDLSDLEYLDEEFHQSLQWMKE---NDITDVLDLTFTVNEEVFGQVTERELKSGGTNV 1378

  Fly   893 AVTLENRQEFVDLYVDFVFNKSVELHYNAFHKGFMKVCSGRVIHIFQPEELMAVVVGNEDYDWQA 957
            .||.:|::|:::..|.:...:.|.....|..:||.:|...|::.:|...||..|:.|..:.|...
Zfish  1379 QVTEKNKKEYIERMVKWRVERGVVQQTQALVRGFYEVVDSRLVSVFDARELELVIAGTAEIDLND 1443

  Fly   958 LQDNCEYREGYTSVDDTIKWFWEVIHDMSEAEKKSFLLFLTGSDRIPIQGMKAL-------KLTI 1015
            .::|.|||.||......|:|||..:...:..::...|.|:||:..:|.:|..||       :..|
Zfish  1444 WRNNTEYRGGYHDGHIVIRWFWGAVERFNNEQRLRLLQFVTGTSSVPYEGFTALRGSNGLRRFCI 1508

  Fly  1016 QPTPDERFLPVAHTCFNLLDLPRYKTKERLKYKLLQAIQQTQGFSL 1061
            :.......||.||||||.||||.|.:...|..|||.|:::|..|.|
Zfish  1509 EKWGKITSLPRAHTCFNRLDLPPYPSYTMLYEKLLIAVEETSTFGL 1554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033 115/368 (31%)
HECTc 739..1059 CDD:214523 108/343 (31%)
hecw1bXP_021336549.1 HECW_N 73..192 CDD:318711
C2_NEDL1-like 213..349 CDD:176073
WW 771..803 CDD:197736
WW 952..983 CDD:197736
HECTc 1223..1552 CDD:214523 108/343 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.