DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and nedd4l

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:XP_021324687.1 Gene:nedd4l / 559634 ZFINID:ZDB-GENE-051118-2 Length:1279 Species:Danio rerio


Alignment Length:590 Identity:166/590 - (28%)
Similarity:268/590 - (45%) Gaps:99/590 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   512 PADVESMRLYLLLPLYHEFVNSKHYKSLQVPFANAIFKLAENPRKVLNKWLAQTPAEYFEHLVQN 576
            |..:.|..:.|..||  |..|:       ||...|:.....||:       :..|:.|       
Zfish   743 PRSLSSPTVTLSSPL--EGANN-------VPIRRAVKDTFSNPQ-------SPQPSPY------- 784

  Fly   577 FLHVVIHIISFKMGLAAASPSAERR--QQLLPYNTELEIILKLMKTLCQINNE----RHDRLNYQ 635
                             :||..:.:  |..||...|:.|...........|:.    ...||.|.
Zfish   785 -----------------SSPKTQHKANQSFLPPGWEMRIAPNGRPFFIDHNSRTTTWEDPRLKYP 832

  Fly   636 IFYWP-------DLSDYADVQQE--YVKWIMADTARDFNICNYSFIFDQSAKTALLQADQALQMH 691
            :....       ||....::.:|  :.:.:.||        ..:|..|.:.|....: |..||..
Zfish   833 VHMRTKASLDPGDLGPLPNLPEEPGWEERVHAD--------GRTFYIDHNNKKTQWE-DPRLQSP 888

  Fly   692 SAMANAATMAFSF---FNY-------GMPISQFIVLNVTRENLVQDSLRELQHYSQSD-LKKPLK 745
            :....|...:..|   ::|       ...|.....:.:.|.|:.::|.|.:....:.| ||..|.
Zfish   889 AITGPAVPYSREFKQKYDYFRKKLKKPADIPNRFEMKLHRNNIFEESYRRIMSLKRPDSLKARLW 953

  Fly   746 IKFHGEEAEDAGGVRKEFFMLLLKDLLDPKYGMFKEYEQS-----RLLWFADLTFETENMYF-LI 804
            |:|..|:..|.|||.:|:|.||.|::.:|.||:| ||..:     ::...:.|..|....|| .|
Zfish   954 IEFESEKGLDYGGVAREWFFLLSKEMFNPYYGLF-EYSATDNYTLQINPNSGLCNEDHLSYFKFI 1017

  Fly   805 GVLCGLAIYNFTIINLPFPLALFKKLLGKPVDLSDLRQLSPPEANSMQSLLDYQGDDFKEVFDLT 869
            |.:.|:|:|:..:::..|....:|.:|||.:.|:|:..:.....||::.:|:   :|..|: ||.
Zfish  1018 GRVAGMAVYHGKLLDGFFIRPFYKMMLGKQITLNDMESVDSEYYNSLKWILE---NDPTEL-DLR 1078

  Fly   870 FEISRDVFGEAETKCLKPNGNEIAVTLENRQEFVDLYVDFVFNKSVELHYNAFHKGFMKVCSGRV 934
            |.|..|.||:.....|||:|:::.||.:|::|::||.:.:.|...|:...|||.:||.::....:
Zfish  1079 FCIDEDNFGQTYQVDLKPSGSDMVVTNDNKKEYIDLVIQWRFVNRVQKQMNAFLEGFTELIPIDL 1143

  Fly   935 IHIFQPEELMAVVVGNEDYDWQALQDNCEYREGYTSVDDTIKWFWEVIHDMSEAEKKSFLL-FLT 998
            |.||...||..::.|..|.|....:.:..|:.||......|:|||:.:. :.:|||:..|| |:|
Zfish  1144 IKIFDENELELLMCGLGDVDVNDWRQHTVYKNGYCPNHPVIQWFWKAVL-LMDAEKRIRLLQFVT 1207

  Fly   999 GSDRIPIQGMKAL-------KLTIQP--TPDERFLPVAHTCFNLLDLPRYKTKERLKYKLLQAIQ 1054
            |:.|:|:.|...|       ..||:.  |||:  ||.||||||.||||.|:|.|.|:.|||.|::
Zfish  1208 GTSRVPMNGFAELYGSNGPQLFTIEQWGTPDK--LPRAHTCFNRLDLPMYETFEDLREKLLMAVE 1270

  Fly  1055 QTQGF 1059
            ..|||
Zfish  1271 NAQGF 1275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033 126/362 (35%)
HECTc 739..1059 CDD:214523 120/336 (36%)
nedd4lXP_021324687.1 C2 <374..430 CDD:326325
WW 473..499 CDD:306827
WW 669..698 CDD:306827
WW 798..829 CDD:197736 5/30 (17%)
WW 856..885 CDD:238122 6/37 (16%)
HECTc 946..1275 CDD:214523 120/336 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.