DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and RCBTB1

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:NP_001339429.1 Gene:RCBTB1 / 55213 HGNCID:18243 Length:531 Species:Homo sapiens


Alignment Length:609 Identity:152/609 - (24%)
Similarity:246/609 - (40%) Gaps:172/609 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ILTPSQIPWTPDTAVQQVAC----GHRHTLFLTATGKVYACGSNDYSQ---LGHDLPTKRPRMSP 85
            :|:|.:|      |..:.||    .....|::|...:|:..|.| ||.   .|.:..|       
Human    12 LLSPQEI------ASIRKACVFGTSASEALYVTDNDEVFVFGLN-YSNCLGTGDNQST------- 62

  Fly    86 FLLIPELQDYVIIQICCGSR----------HSLALSDWGQVLSWGDNDCGQLGHATDKEIVQLPK 140
              |:|:.     ::..||.:          |.|..::.|.|.:||.|...|||:.|..:.:...:
Human    63 --LVPKK-----LEGLCGKKIKSLSYGSGPHVLLSTEDGVVYAWGHNGYSQLGNGTTNQGIAPVQ 120

  Fly   141 VVRQLVTKTVVQIACGNNHSLALTSCGELYSWGSNIYGQLGVNS------PNDLTHCNYPLRLTT 199
            |...|:.|.||::|||::||:||.:.||:::||.|..||:|..|      |..:|:|   |.:..
Human   121 VCTNLLIKQVVEVACGSHHSMALAADGEVFAWGYNNCGQVGSGSTANQPTPRKVTNC---LHIKR 182

  Fly   200 LLGIPLAAIACGGNHSFLISKSGAVFGWGRNNCGQLGLNDETNRSYPTQLKTLRTLGVRFVACGD 264
            ::|     ||||...|..:..:|.|:|||.|..|||||.:..|:..|.::..|.::.|..:.||.
Human   183 VVG-----IACGQTSSMAVLDNGEVYGWGYNGNGQLGLGNNGNQLTPVRVAALHSVCVNQIVCGY 242

  Fly   265 EFSVFLTNEGGVFTCGAGAYGQLGHGFSSNEMLPRMVMELMGSTITQVACGNRHTLALVPSRGRV 329
            ..::.||:||.::..||..|||||.|..:|.:.|..:|......:...||.:.||.|.....|.|
Human   243 AHTLALTDEGLLYAWGANTYGQLGTGNKNNLLSPAHIMVEKERVVEIAACHSAHTSAAKTQGGHV 307

  Fly   330 YAFGLGSSGQLGTRSTKSLMLPQV--------VIGPWVSPSGSALLQSNDSQVSLVIRQIFSGGD 386
            |.:| ...||       |::||.:        |...:.:|:.|..|.|                 
Human   308 YMWG-QCRGQ-------SVILPHLTHFSCTDDVFACFATPAVSWRLLS----------------- 347

  Fly   387 QSIVTTTLFVDKVPPEDFRNYNPKSQILTLTAEVTKQCAQCKQGLQSDMDLLSSIELIFRSQACW 451
                        |..|||         ||:.           :.|:.:.|...:.:|.||     
Human   348 ------------VEHEDF---------LTVA-----------ESLKKEFDSPETADLKFR----- 375

  Fly   452 NGSFLLDHDRHFGCSVRNHGLDLKAAQLAFDNLRAVENESIRQVIWDNITKELVGSLVCSPADVE 516
                 :|     |..:..|...||        :|.....|:.|..|:...||::        :::
Human   376 -----ID-----GKYIHVHKAVLK--------IRCEHFRSMFQSYWNEDMKEVI--------EID 414

  Fly   517 SMRLYLLLPLYHEFVNSKHYKSLQVPFANAIFKL------AENPRKVLNKWLAQTPAEYFEHLVQ 575
            ...    .|:|..|:...:..::.:|..:||..|      .||..|.|           .:|:::
Human   415 QFS----YPVYRAFLQYLYTDTVDLPPEDAIGLLDLATSYCENRLKKL-----------CQHIIK 464

  Fly   576 NFLHVVIHIISFKMGLAAASPSAE 599
            ..:.|.   .:|.:..||....||
Human   465 RGITVE---NAFSLFSAAVRYDAE 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826 7/30 (23%)
RCC1 59..110 CDD:278826 13/63 (21%)
RCC1 114..163 CDD:278826 19/48 (40%)
RCC1 167..218 CDD:278826 19/56 (34%)
RCC1 221..270 CDD:278826 17/48 (35%)
RCC1 273..322 CDD:278826 17/48 (35%)
RCC1_2 309..339 CDD:290274 9/29 (31%)
RCC1 327..390 CDD:278826 14/70 (20%)
HECTc 715..1060 CDD:238033
HECTc 739..1059 CDD:214523
RCBTB1NP_001339429.1 RCC1 1 40..91 13/65 (20%)
ATS1 43..>316 CDD:227511 94/296 (32%)
RCC1 2 93..145 21/51 (41%)
RCC1 3 147..198 19/58 (33%)
RCC1 4 199..250 18/50 (36%)
RCC1 5 252..302 17/49 (35%)
RCC1 6 304..356 19/97 (20%)
BTB_POZ_RCBTB1_CLLD7 350..466 CDD:349662 33/181 (18%)
BACK_RCBTB1 466..531 CDD:350603 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.