DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and Wwc2

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:NP_598552.2 Gene:Wwc2 / 52357 MGIID:1261872 Length:1187 Species:Mus musculus


Alignment Length:508 Identity:94/508 - (18%)
Similarity:157/508 - (30%) Gaps:173/508 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QILTPSQIPWTPDTAVQQVACGHRHTLFLTATGKVYACGSND--YSQLGHDLPTKRPRMSPFLLI 89
            |.|:.|.:..:..:::..:| ..|.:|..::.|.:.:..|::  ||..|..:.|.......||| 
Mouse   428 QSLSSSTLSMSSGSSLGSLA-SSRGSLNTSSRGSLNSLSSSELYYSSQGDQMDTDYQYKLDFLL- 490

  Fly    90 PELQDYVIIQICCGSRHSLALSDWGQVLSWGDNDC-------GQLG----------HATDKEIVQ 137
            .|...|:               ..|.:.:..:|:.       ||.|          |.|  .:.:
Mouse   491 QEKGGYI---------------PSGPITTIHENEVVKSPSQPGQSGLCGVGVTASSHTT--PLTE 538

  Fly   138 LPKVVRQLVTKTVVQIACGNNHSLALTSC--GELYSWGSNIYGQLGVNSPNDLTHCNYPLRLTTL 200
            ..|.|..|.:::.:.........|.|.|.  |..:....:.:       |.|...|....|    
Mouse   539 ASKSVASLSSRSSLSSLSPPGSPLVLDSVFPGSSHDTSPHQF-------PTDFEDCELSRR---- 592

  Fly   201 LGIPLAAIACGGNHSFLISKSGA-----VFGWGRNNC-GQL---GLNDETNRSYPTQL------- 249
                .|.:..|.|.:.|.|.||.     :...|.::| |:|   |..| ..:|.|.:.       
Mouse   593 ----FADVGLGENQALLDSDSGGASQPLLEDKGLSDCPGELLCEGATD-VEKSLPKRRGLHLRGD 652

  Fly   250 KTLRTLGVRFVACGDEFSVFLTNEGGVFTCGAGAYGQLGHGFSSNEMLPRMVMELMGSTITQVAC 314
            ||.|.    ..|..||   .:..:.||:.......|::       |.:|....::......||..
Mouse   653 KTTRV----SAAASDE---SVAGDSGVYEASMKQPGEM-------EDVPYSEEDVTIVETAQVQI 703

  Fly   315 GNRHT------LALVPSRGRVYAFGLGSSGQLGTRSTKSLMLPQVVIGPWVSPSGSALLQSNDSQ 373
            |.|:.      :.::.....::||.:..|.::..|                    .|||.|    
Mouse   704 GLRYDTKSSSFMVIIAQLRNLHAFSIPHSSKVYFR--------------------VALLPS---- 744

  Fly   374 VSLVIRQIFSGGDQSIVTTTLFVDKV-PPEDFRNYNPKSQILTLTAEVTKQCAQCKQGLQSDMDL 437
                          |...:.||..|| ||.:...||...::      ...|.|..::.|:.|:  
Mouse   745 --------------SADVSCLFRTKVHPPTESVLYNDVFRV------AVSQAALQQKTLRVDL-- 787

  Fly   438 LSSIELIFRSQACWNGSFLLDHDRHFGCSVRNH-------GLDLKAAQLAFDN 483
                                       ||...|       |..:..|.|.|.|
Mouse   788 ---------------------------CSASKHRREECLAGTQISLADLPFSN 813

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826 6/27 (22%)
RCC1 59..110 CDD:278826 11/52 (21%)
RCC1 114..163 CDD:278826 11/65 (17%)
RCC1 167..218 CDD:278826 8/50 (16%)
RCC1 221..270 CDD:278826 16/64 (25%)
RCC1 273..322 CDD:278826 9/54 (17%)
RCC1_2 309..339 CDD:290274 7/35 (20%)
RCC1 327..390 CDD:278826 9/62 (15%)
HECTc 715..1060 CDD:238033
HECTc 739..1059 CDD:214523
Wwc2NP_598552.2 WW 12..41 CDD:278809
WW 59..88 CDD:278809
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 438..464 4/26 (15%)
C2_Kibra 699..822 CDD:176062 33/188 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 830..849
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 874..963
Phage_Nu1 <1088..>1146 CDD:294991
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.