DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and UBR5

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:NP_056986.2 Gene:UBR5 / 51366 HGNCID:16806 Length:2799 Species:Homo sapiens


Alignment Length:373 Identity:100/373 - (26%)
Similarity:158/373 - (42%) Gaps:58/373 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   721 RENLVQDSLRELQHYSQSDLKKPLKIKFHG----------EEAEDAGGVRKEFFMLLLKDLLDPK 775
            ||| ..||:.:|.....|:..:....|.||          ::.:|.......|:....:....|:
Human  2454 REN-GADSILDLGLVDSSEKVQQENRKRHGSSRSVVDMDLDDTDDGDDNAPLFYQPGKRGFYTPR 2517

  Fly   776 YGMFKEYEQSRLLWFADLTFETENMYFLIGVLCGLAIYNFTIINLPFPLALFKKLLGKPVDLSDL 840
            .|   :..::||           |.:..||.:.||.:....:..:.....:.|.|||:.|:..|.
Human  2518 PG---KNTEARL-----------NCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDF 2568

  Fly   841 RQLSPPEANSM-QSLLDYQGDDFKEVF---DLTFEI---SRDVFGEAETKCLKPNGNEIAVTLEN 898
            ....|....|: |.:|..|..|...||   ||.|.|   ..:..|:.|   |.|||..|.||.:|
Human  2569 AFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAIDLCKEEGGGQVE---LIPNGVNIPVTPQN 2630

  Fly   899 RQEFVDLYVDFVFNKSVELHYNAFHKGFMKVCSGRVIHIFQPEELMAVVVGNEDYDWQALQDNCE 963
            ..|:|..|.:.......|...:|..||.:.|.....:.....|:...:|.|..:.:.|.|     
Human  2631 VYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQML----- 2690

  Fly   964 YREGYTSVDDTI-----------KWFWEVIHDMSEAEKKSFLLFLTGSDRIPI--QGMKAL-KLT 1014
              ..:||.:|..           :|||.::..||..|::..:.|.|.|..:|.  :|.:.: .:|
Human  2691 --ISFTSFNDESGENAEKLLQFKRWFWSIVEKMSMTERQDLVYFWTSSPSLPASEEGFQPMPSIT 2753

  Fly  1015 IQPTPDERFLPVAHTCFNLLDLPRYKTKERLKYKLLQAIQQTQGFSLV 1062
            |:| ||::.||.|:||.:.|.:|.|.:|:.||.|||.|| :|:.|..|
Human  2754 IRP-PDDQHLPTANTCISRLYVPLYSSKQILKQKLLLAI-KTKNFGFV 2799

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033 98/369 (27%)
HECTc 739..1059 CDD:214523 91/350 (26%)
UBR5NP_056986.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..175
CUE_UBR5 184..230 CDD:270606
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..352
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 579..648
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 999..1031
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1052..1075
ZnF_UBR1 1177..1244 CDD:197698
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1299..1318
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1515..1740
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1859..1890
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1984..2021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2117..2142
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2323..2392
PolyA 2389..2452 CDD:197769
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2473..2493 3/19 (16%)
HECTc 2501..2796 CDD:214523 87/320 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.