DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and ASCC1

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:NP_001185728.1 Gene:ASCC1 / 51008 HGNCID:24268 Length:400 Species:Homo sapiens


Alignment Length:186 Identity:45/186 - (24%)
Similarity:68/186 - (36%) Gaps:67/186 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   827 FKKLLGKPVDLSDLRQLSPPEANSMQSL-LDYQ--------------GDDFKEVFDLTFEISRDV 876
            |:..|..|..|.:|..|:.......|.: ||.|              ||..|::           
Human    59 FRSTLRAPSLLYNLIHLNTSNDCGFQKITLDCQNIYTWKSRHIVGKRGDTRKKI----------- 112

  Fly   877 FGEAETKCL----KP-NGNEIAVTLENR------QEFVDLYVDFVFNKSVELHYNAF-------H 923
              |.|||..    || ...||.:|.::|      :..:|:.:|....|....|:.||       .
Human   113 --EMETKTSISIPKPGQDGEIVITGQHRNGVISARTRIDVLLDTFRRKQPFTHFLAFFLNEVEVQ 175

  Fly   924 KGFMKV-------CS---GRVIHIFQ-PEEL-----MAVVVGNEDYDWQALQDNCE 963
            :||::.       ||   |....||| |::|     |.|::..|:     :|..||
Human   176 EGFLRFQEEVLAKCSMDHGVDSSIFQNPKKLHLTIGMLVLLSEEE-----IQQTCE 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033 45/186 (24%)
HECTc 739..1059 CDD:214523 45/186 (24%)
ASCC1NP_001185728.1 Required for interaction with ASCC3. /evidence=ECO:0000269|PubMed:29997253 1..53
vigilin_like_KH 99..148 CDD:239087 13/61 (21%)
PLN00108 157..370 CDD:177724 20/75 (27%)
AKAP7_NLS 161..349 CDD:287446 19/71 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.