DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and Magi1

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:XP_038964101.1 Gene:Magi1 / 500261 RGDID:1586025 Length:1491 Species:Rattus norvegicus


Alignment Length:317 Identity:63/317 - (19%)
Similarity:101/317 - (31%) Gaps:87/317 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 VNSPNDLTH-CNYPLRLTTLLGIPLAAIACGGNHSF--LISKSGAVFGWGRNNCGQLGLNDETNR 243
            |.||....| .|.|..||.....|.     |..:|.  :.|.||:..|.|....|..|:.....:
  Rat   936 VPSPASSHHSSNQPASLTEEKRTPQ-----GSQNSLNTVSSGSGSTSGIGSGGGGGSGVVSAVLQ 995

  Fly   244 SYPTQLKTLRTLGVRFVACGDEFSVFLTNEGGVF---TCGAGAY--GQLGHGFSSNE----MLPR 299
            .|..:::.....|..||...   ||.....|..|   .|.|..:  |::..|..::.    .:..
  Rat   996 PYDVEIRRGENEGFGFVIVS---SVSRPEAGTTFAGNACVAMPHKIGRIIEGSPADRCGKLKVGD 1057

  Fly   300 MVMELMGSTITQVA----------CGNRHTLALVPSRGRVYAFGLGSS------------GQLGT 342
            .::.:.|.:||..:          .||..||.::|......|..|.::            .|.||
  Rat  1058 RILAVNGCSITNKSHSDIVNLIKEAGNTVTLRIIPGDESSNATLLTNAEKIATITTTHAPSQQGT 1122

  Fly   343 RSTKSLMLPQ-----VVIGPWVSPS---------------GSALLQSNDSQVSLVIRQIFSGGDQ 387
            :.|::...|:     ...||..:..               |.:|....:..:.|.:.::...|  
  Rat  1123 QETRTTTKPKPDSQFEFKGPQATQEQDFYTVELERGAKGFGFSLRGGREYNMDLYVLRLAEDG-- 1185

  Fly   388 SIVTTTLFVDKVPPEDFRNYNPKSQILTLTAEVTKQCAQCKQGLQSDMDLLSSIELI 444
                        |.|.........:||.:..|.||           :|....:||||
  Rat  1186 ------------PAERCGKMRIGDEILEINGETTK-----------NMKHSRAIELI 1219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826 11/38 (29%)
RCC1 221..270 CDD:278826 12/48 (25%)
RCC1 273..322 CDD:278826 13/67 (19%)
RCC1_2 309..339 CDD:290274 9/51 (18%)
RCC1 327..390 CDD:278826 13/94 (14%)
HECTc 715..1060 CDD:238033
HECTc 739..1059 CDD:214523
Magi1XP_038964101.1 NK 122..293 CDD:418433
WW 302..331 CDD:395320
WW 362..393 CDD:197736
PDZ 469..555 CDD:214570
PDZ 640..723 CDD:214570
MAGI_u5 724..806 CDD:406953
PDZ_signaling 847..922 CDD:238492
PDZ_signaling 996..1091 CDD:238492 19/97 (20%)
PDZ 1152..1234 CDD:214570 16/93 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.