DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and arel1

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:NP_001011393.1 Gene:arel1 / 496863 XenbaseID:XB-GENE-5852856 Length:806 Species:Xenopus tropicalis


Alignment Length:906 Identity:174/906 - (19%)
Similarity:302/906 - (33%) Gaps:288/906 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 ETNRSYPTQLKTLR--TLGVRFVACGDEFSVFLTNEGGVFTCGAGAYG-QLGHG-----FSSNEM 296
            |.:...|..|:.|:  |..|..||       |...:.|.:.......| .:||.     ||...:
 Frog   106 ELDLEVPITLEVLQDSTRNVMKVA-------FTVRKSGRYQINISIGGLNIGHSP
YYKIFSPGAV 163

  Fly   297 LPRMVMELMGSTITQVACGNRHTLALVPSRGRVYAFGLGSSGQLGTRSTKSLMLPQVVIGPWVSP 361
            :|.....:...:...:.||.:|||.:||            ..|.|..::.||             
 Frog   164 VPSKTQIVSHFSTLVLKCGEQHTLQVVP------------RDQYGNHTSDSL------------- 203

  Fly   362 SGSALLQSNDSQVSLVIRQIFSGGDQSIVTTTLFVDKVPPEDFRNYNPKSQILTLT----AEVTK 422
                                                    :|..:|     ||||:    ..|..
 Frog   204 ----------------------------------------KDLESY-----ILTLSELGVVGVAD 223

  Fly   423 QCAQCKQGLQSDMDLLSSIELIFRSQACWNGSFLLDHDRHFGCSVRNHGLDLKAAQLAFDNLRAV 487
            .|.|......|...:|..:.|:  ...|            |..::|..||.:....  |..:...
 Frog   224 GCLQVSVCSGSQNRVLLHLALL--QTGC------------FQATLRFQGLPINNGN--FQIIVLT 272

  Fly   488 ENESIRQVIWDNITKELVGSLVCSPADVESMRLYLLLPLYHEFVNSKHYKSLQVPFANAIFKLAE 552
            :.|  :.::.:|:::..||                                  |.|...::..:.
 Frog   273 DGE--KTIVDNNVSRSGVG----------------------------------VFFEGYLYPPSS 301

  Fly   553 NPRKVLNKWLAQTPAEYFEHLVQNFLHVVIHIISFKMGLAAASPSAERRQQLLPYNTELEIILKL 617
            :|         ..|.::                      .::|.|          |.|       
 Frog   302 SP---------NIPGQH----------------------RSSSTS----------NDE------- 318

  Fly   618 MKTLCQINNERH--DRLN--YQIFYW--PDLSDYADVQQEYVKWIMADTARDFNIC-NYSFIF-- 673
                 :.|.:.|  |||.  .:::::  |......:.....:.|.:.    .|.:| ...|::  
 Frog   319 -----ESNADGHTVDRLKKPKKVYFYITPKQLSVKEFYLRIIPWRLF----TFRVCPGTKFLYLP 374

  Fly   674 -DQSAKTALLQADQALQ--------------------MHSAMANAATMAFSFFNYGMPISQF--- 714
             |.......||.|..||                    :|..:..:.|.......:...:.|.   
 Frog   375 PDPLHGLLSLQVDDGLQPPIEISCKDRNIMAATFTRFLHLNIGGSETFQDKVTFFQKELRQIHCK 439

  Fly   715 -----IVLNVTRENLVQDSLRELQHYSQSDLKKPLKIKFHGEEAEDAGGVRKEFFMLLLKDLLDP 774
                 :.|.|.|.:|::.|||..:::|.||..|..::.|..|||.|.||.|:|:|.|:.|.|.|.
 Frog   440 KTRCKVTLKVNRHSLLESSLRATRNFSASDWCKNFEVVFQDEEALDWGGPRREWFELICKTLFDT 504

  Fly   775 KYGMFKEYEQSRLLWFADLTFETEN----MYFLIGVLCGLAIYNFT-------IINLPFPLALFK 828
            ...:|..:..|.............|    :|...|.:.|..::..:       ::...|..:...
 Frog   505 NNQLFIRFSDSNQGLVHPNPCRPPNIRVKLYEFAGRVVGKCLFESSLGGGCEQLVRARFTRSFLA 569

  Fly   829 KLLGKPVDLSDLR------QLSPPE--ANSMQSLLDYQGDDFKEVFDLTFEISRDVFGEA----E 881
            :::|       ||      :...|:  ...:|.:|.      .:|.|.....:.:.:|.|    :
 Frog   570 QIIG-------LRMHYKYFETDDPDFFQTKVQYILT------NDVIDTELSFAEEKYGRAGQLEK 621

  Fly   882 TKCLKPNGNEIAVTLENRQEFVDLYVDFVFNKSVELHYNAFHKGFMKVCSGRVIHIFQPEELMAV 946
            ...|.|.|::|.||.||:..:::|..:...:..|....:.|.||..::....::.||...||..:
 Frog   622 VVELIPGGSQILVTNENKVYYLNLLANHRLSNQVREEVDHFLKGLNELVPDNLLGIFDENELELL 686

  Fly   947 VVGN-----EDYDWQA--LQDNCEYREGYTSVDDTIKWFWEVIHDMSEAEKKSFLLFLTGSDRIP 1004
            :.|.     :|:...|  :..:..:||      ..:.|||.|:..:::.|....|.|.|||.::|
 Frog   687 MCGTGHIAVQDFQAHAVVIGGSWHFRE------KVMSWFWAVVSSLTQEELARLLQFTTGSSQLP 745

  Fly  1005 IQGMKALKLTIQ--PTPDERFLPVAHTCFNLLDLPRYKTKERLKYKLLQAIQQ-TQGFSLV 1062
            ..|..||..:.|  .:|....||.||||||.|.||.|.:.|.:...|..||.: .:||.::
 Frog   746 PGGFAALSPSFQIIGSPTHGTLPTAHTCFNQLCLPTYDSYEEMHKMLKLAISEGCEGFGML 806

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826 8/31 (26%)
RCC1 273..322 CDD:278826 12/54 (22%)
RCC1_2 309..339 CDD:290274 7/29 (24%)
RCC1 327..390 CDD:278826 4/62 (6%)
HECTc 715..1060 CDD:238033 97/377 (26%)
HECTc 739..1059 CDD:214523 87/352 (25%)
arel1NP_001011393.1 Filamin 56..153 CDD:366210 13/53 (25%)
HECTc 447..804 CDD:238033 97/375 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.