DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and NEDD4

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:NP_001271267.1 Gene:NEDD4 / 4734 HGNCID:7727 Length:1319 Species:Homo sapiens


Alignment Length:359 Identity:118/359 - (32%)
Similarity:199/359 - (55%) Gaps:23/359 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   717 LNVTRENLVQDSLRELQHYSQSD-LKKPLKIKFHGEEAEDAGGVRKEFFMLLLKDLLDPKYGMFK 780
            :.:.|..:::||.|.:....::| ||..|.|:|.||:..|.|||.:|:|.|:.|::.:|.||:| 
Human   964 MKLRRATVLEDSYRRIMGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLISKEMFNPYYGLF- 1027

  Fly   781 EYEQS-----RLLWFADLTFETENMYF-LIGVLCGLAIYNFTIINLPFPLALFKKLLGKPVDLSD 839
            ||..:     ::...:.|..|....|| .||.:.|:|:|:..:::..|....:|.:|.||:.|.|
Human  1028 EYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLHKPITLHD 1092

  Fly   840 LRQLSPPEANSMQSLLDYQGDDFKEVFDLTFEISRDVFGEAETKCLKPNGNEIAVTLENRQEFVD 904
            :..:.....||::.:|:   :|..|: ||.|.|..::||:.....||..|:||.||.:|::|::.
Human  1093 MESVDSEYYNSLRWILE---NDPTEL-DLRFIIDEELFGQTHQHELKNGGSEIVVTNKNKKEYIY 1153

  Fly   905 LYVDFVFNKSVELHYNAFHKGFMKVCSGRVIHIFQPEELMAVVVGNEDYDWQALQDNCEYREGYT 969
            |.:.:.|...::....||.:||.::....:|.||...||..::.|..|.|....:::.:|:.||:
Human  1154 LVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDVNDWREHTKYKNGYS 1218

  Fly   970 SVDDTIKWFWEVIHDMSEAEKKSFLLFLTGSDRIPIQGMKAL-------KLTIQP--TPDERFLP 1025
            :....|:|||:.:..|...::...|.|:||:.|:|:.|...|       ..|::.  ||::  ||
Human  1219 ANHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPEK--LP 1281

  Fly  1026 VAHTCFNLLDLPRYKTKERLKYKLLQAIQQTQGF 1059
            .||||||.||||.|::.|.|..||..||:.||||
Human  1282 RAHTCFNRLDLPPYESFEELWDKLQMAIENTQGF 1315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033 118/359 (33%)
HECTc 739..1059 CDD:214523 112/335 (33%)
NEDD4NP_001271267.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..229
C2 <517..570 CDD:417471
Mediates interaction with TNIK. /evidence=ECO:0000250 578..981 4/16 (25%)
WW 611..643 CDD:197736
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 755..780
WW 769..798 CDD:395320
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 796..834
WW 842..871 CDD:395320
WW 893..925 CDD:197736
HECTc 986..1315 CDD:214523 112/335 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.