DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and nek8

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:XP_012812229.1 Gene:nek8 / 448753 XenbaseID:XB-GENE-990378 Length:698 Species:Xenopus tropicalis


Alignment Length:388 Identity:106/388 - (27%)
Similarity:180/388 - (46%) Gaps:55/388 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LYCWGSTSHGQLGLGGIEDEQILTPSQIPWTPDTAVQQVACGHRHTLFLTATGKVYACGSNDYSQ 71
            :|.|||         ||.     ||.::|.. :|.|.||:.|......:|.:|::....:.....
 Frog   322 VYTWGS---------GIS-----TPLRLPML-NTEVVQVSAGRTQKAGVTKSGRLIMWEATPVGT 371

  Fly    72 LGHDLPTK----RPR-MSPFLLIPELQDYVIIQ-ICCGSRHSLALSDWGQVLSWGDNDCGQLGHA 130
            ....||..    :|: :|.||   |.|..|.|: :.||...:..|:|.|.::::|....|.||||
 Frog   372 GAPSLPGSIEHAQPQFISRFL---EGQSGVTIKHVSCGDLFTACLTDRGIIMTFGSGSNGCLGHA 433

  Fly   131 TDKEIVQLPKVVRQLVTKTVVQIACGNNHSLALTSCGELYSWGSNIYGQLGVNSPNDLTHCNYPL 195
            ...::.| ||:|..|:...:|.::||.:|::|:::..|::|||....|:||:.|....   |.|.
 Frog   434 NFNDVTQ-PKIVEDLLGYEIVHVSCGASHAIAVSNEKEVFSWGRGDNGRLGLGSQESY---NSPQ 494

  Fly   196 RLTTLLGIPLAAIACGGNHSFLISKSGAVFGWGRNNCGQLGLN-----------DETNRSY---P 246
            ::..........:.||.:.|.:::.:..:...|.|...:||.:           |:...:|   |
 Frog   495 QVIIPPEYEAQRVVCGIDSSMILTVANQLLACGSNRFNKLGFDRILSASEPSSEDQVEEAYTFTP 559

  Fly   247 TQLKTLRTLGVRFVACGDEFSVFLTNEGGVFTCGAGAYGQLGHGFSSNEMLPRMVMELMGSTITQ 311
            .|...|....:.....|...|..:|..|..:|.|:..:||||.....|..:|.:|..|.|..:|.
 Frog   560 IQSAPLNQEAILCADVGTSHSAVVTALGQCYTFGSNQHGQLGTSAHRNSRVPCLVSALQGVKVTM 624

  Fly   312 VACGNRHTLALVPSRGRVYAFGLGSSGQLGTRSTKSLMLPQVVIGPWVSPSGSALLQSNDSQV 374
            ||||:.:|:| |.:.|:|:.:|.|:.|:||.|. :.:.:|::|           .|:.|.|.|
 Frog   625 VACGDAYTVA-VGAEGQVFTWGKGARGRLGRRD-EGIGIPKIV-----------QLEENHSYV 674

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826 14/47 (30%)
RCC1 59..110 CDD:278826 13/56 (23%)
RCC1 114..163 CDD:278826 16/48 (33%)
RCC1 167..218 CDD:278826 13/50 (26%)
RCC1 221..270 CDD:278826 11/62 (18%)
RCC1 273..322 CDD:278826 18/48 (38%)
RCC1_2 309..339 CDD:290274 12/29 (41%)
RCC1 327..390 CDD:278826 14/48 (29%)
HECTc 715..1060 CDD:238033
HECTc 739..1059 CDD:214523
nek8XP_012812229.1 STKc_Nek8 3..258 CDD:270859
S_TKc 4..256 CDD:214567
ATS1 320..657 CDD:227511 100/358 (28%)
RCC1 421..465 CDD:278826 15/44 (34%)
RCC1 470..517 CDD:278826 13/49 (27%)
RCC1 587..635 CDD:278826 19/48 (40%)
RCC1 638..687 CDD:278826 14/49 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.