DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and nedd4l

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:XP_012815048.1 Gene:nedd4l / 448382 XenbaseID:XB-GENE-489248 Length:1290 Species:Xenopus tropicalis


Alignment Length:360 Identity:125/360 - (34%)
Similarity:200/360 - (55%) Gaps:25/360 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   717 LNVTRENLVQDSLRELQHYSQSD-LKKPLKIKFHGEEAEDAGGVRKEFFMLLLKDLLDPKYGMFK 780
            :.:.|.|:.::|.|.:....:.| ||..|.|:|..|:..|.|||.:|:|.||.|::.:|.||:| 
 Frog   935 MKLHRNNIFEESYRRIMSVKRPDVLKARLWIEFESEKGLDYGGVAREWFFLLSKEMFNPYYGLF- 998

  Fly   781 EYEQS-----RLLWFADLTFETENMYF-LIGVLCGLAIYNFTIINLPFPLALFKKLLGKPVDLSD 839
            ||..:     ::...:.|..|....|| .||.:.|||:::..:::..|....:|.:|||.:.|.|
 Frog   999 EYSATDNYTLQINPNSGLCNEDHLSYFTFIGRIAGLAVFHGKLLDGFFIRPFYKMMLGKQITLKD 1063

  Fly   840 LRQLSPPEANSMQSLLDYQGDDFKEVFDLTFEISRDVFGEAETKCLKPNGNEIAVTLENRQEFVD 904
            :..:.....||::.:|:   :|..|: ||.|.|..:.||:.....|||||:|:.||.:|::|::|
 Frog  1064 MESVDSEYYNSLKWILE---NDPTEL-DLRFCIDEENFGQTYQVDLKPNGSEMVVTNDNKREYID 1124

  Fly   905 LYVDFVFNKSVELHYNAFHKGFMKVCSGRVIHIFQPEELMAVVVGNEDYDWQALQDNCEYREGYT 969
            |.:.:.|...|:...|||.:||.::....:|.||...||..::.|..|.|....:.:..|:.||.
 Frog  1125 LVIQWRFVNRVQKQMNAFLEGFTELIPIDLIKIFDENELELLMCGLGDVDVNDWRQHTLYKNGYC 1189

  Fly   970 SVDDTIKWFWEVIHDMSEAEKKSFLL-FLTGSDRIPIQGMKAL-------KLTIQP--TPDERFL 1024
            .....|:|||:.:. :.:|||:..|| |:||:.|:|:.|...|       ..||:.  :||:  |
 Frog  1190 PNHPAIQWFWKAVL-LMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPDK--L 1251

  Fly  1025 PVAHTCFNLLDLPRYKTKERLKYKLLQAIQQTQGF 1059
            |.||||||.||||.|.:.|.|:.|||.|::..|||
 Frog  1252 PRAHTCFNRLDLPPYDSFEDLREKLLMAVENAQGF 1286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033 125/360 (35%)
HECTc 739..1059 CDD:214523 119/336 (35%)
nedd4lXP_012815048.1 C2 <389..442 CDD:301316
WW 485..513 CDD:238122
WW 683..712 CDD:278809
WW 796..826 CDD:238122
WW 845..896 CDD:197736
HECTc 933..1287 CDD:238033 125/360 (35%)
HECTc 957..1286 CDD:214523 119/336 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.