DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and rcbtb2

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:NP_001004950.1 Gene:rcbtb2 / 448359 XenbaseID:XB-GENE-952598 Length:526 Species:Xenopus tropicalis


Alignment Length:305 Identity:101/305 - (33%)
Similarity:150/305 - (49%) Gaps:31/305 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 QVAC---GHRHTLFLTATGKVYACGSNDYSQLGHD-----LPTKRPRMSPFLLIPELQDYVIIQI 100
            |.||   .....|:||...:|:..|:|....||..     |..:|        |..|....|:.:
 Frog    22 QQACVFGAGNEVLYLTKNDEVFVMGTNSSGCLGTGDAQSILEPRR--------IDMLSGKRIVSL 78

  Fly   101 CCGS-RHSLALSDWGQVLSWGDNDCGQLGHATDKEIVQLPKVVRQLVTKTVVQIACGNNHSLALT 164
            ..|| .|.:.::..|:|.|||.|...|||:.:..:.:...:|...|:.|..:.:|||::||:.||
 Frog    79 SYGSGPHVVIVTSDGEVYSWGHNAYSQLGNGSTNQALSPCQVSTNLINKKAISVACGSHHSMVLT 143

  Fly   165 SCGELYSWGSNIYGQLGVNS------PNDLTHCNYPLRLTTLLGIPLAAIACGGNHSFLISKSGA 223
            ..||:|:||.|..||:|..|      |..:|.|   |:..|::|     ||||...|..:..:|.
 Frog   144 CDGEVYAWGYNNSGQVGSGSTANQPIPRKVTSC---LQNKTVIG-----IACGQMSSMAVVDNGE 200

  Fly   224 VFGWGRNNCGQLGLNDETNRSYPTQLKTLRTLGVRFVACGDEFSVFLTNEGGVFTCGAGAYGQLG 288
            |:.||.|..|||||....|:..|.::..|:.:.|..|.||...::.||:||.::..||.:|||||
 Frog   201 VYAWGYNGNGQLGLGSSGNQPTPCRIAALQGIRVEQVVCGYAHTLALTDEGVMYAWGANSYGQLG 265

  Fly   289 HGFSSNEMLPRMVMELMGSTITQVACGNRHTLALVPSRGRVYAFG 333
            .|..||:..|..|:......:...||.:.||.|.....|:||.:|
 Frog   266 TGNKSNQSYPVQVIVDKERIVEIAACHSSHTSAAKSQSGQVYMWG 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826 4/13 (31%)
RCC1 59..110 CDD:278826 13/56 (23%)
RCC1 114..163 CDD:278826 17/48 (35%)
RCC1 167..218 CDD:278826 21/56 (38%)
RCC1 221..270 CDD:278826 17/48 (35%)
RCC1 273..322 CDD:278826 18/48 (38%)
RCC1_2 309..339 CDD:290274 9/25 (36%)
RCC1 327..390 CDD:278826 4/7 (57%)
HECTc 715..1060 CDD:238033
HECTc 739..1059 CDD:214523
rcbtb2NP_001004950.1 ATS1 <17..269 CDD:227511 88/262 (34%)
RCC1 250..298 CDD:366085 18/47 (38%)
BTB_POZ 349..465 CDD:365784
BACK_RCBTB2 462..526 CDD:350604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.