DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and kibra

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:NP_001034055.1 Gene:kibra / 41783 FlyBaseID:FBgn0262127 Length:1288 Species:Drosophila melanogaster


Alignment Length:448 Identity:82/448 - (18%)
Similarity:149/448 - (33%) Gaps:159/448 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   474 LKAAQLAFDNLRAVENESIRQVIW-----DNITKELVGSLVCSPA------DVESMRLYLLL--- 524
            |.|||...:|.|.:.:...::::|     :::......|.:||.:      |.|.:|..|:|   
  Fly   148 LSAAQDQLENKREMFDVKQQRLLWAQEEYNHLKLAASRSSLCSSSSSMSRHDPELLRADLMLARE 212

  Fly   525 ---PLYHEFVNSKHYKSLQVPFANAIFKLAE--NPRKVLNKWLAQTPAEYFEHLVQNFLHVV--I 582
               .|..|..:..:..|......|.::.:.|  |.|                   :|..:.:  :
  Fly   213 RVHQLKQELTHITNDISYTERGMNTLYSVGEKINAR-------------------ENGCYDIAEV 258

  Fly   583 HIISFKMGLAAASPSAERRQQLLPYNTEL----EIILKLMKTLCQINNERHDRLNYQIFYWPDLS 643
            |.|               |:::|..:..|    ::..:||::|.||.||                
  Fly   259 HAI---------------REEMLKVHKSLVSGEKVREELMRSLVQIKNE---------------- 292

  Fly   644 DYADVQQEYVKWIMADTARDFN-IC---------------NYSFIFDQSAKTALLQAD------- 685
                :.::.:....:|.|..|: :|               |....|.:.|||....|:       
  Fly   293 ----LGRQQISEENSDLASPFDRVCVASQTDLCGSSGENLNGGARFAEMAKTKWQYAEWRKHIKK 353

  Fly   686 --QALQMHSAMANAATMAFSFFNYGMPISQFIVLNVTRENLVQD----SLR-----------ELQ 733
              |.|..|........:...        ...|:|...:|.|:.|    ||:           :.:
  Fly   354 LQQQLADHVERIEPGQLESD--------KDRILLIQEKEKLLNDLNSISLKSRSEEEKRVIHQTR 410

  Fly   734 HYSQSDLKKPL---------KIKFHGEEAEDAGGVRKEFFMLLLKDLLDPKYGMFKEYEQSRLLW 789
            |..:.|||:..         :::||.|:.             ||.|.|.......|..|:....:
  Fly   411 HKLEEDLKEAYEANNTCVANRLRFHEEKQ-------------LLLDKLQEALKSTKLLEERLKSF 462

  Fly   790 FADLTFETENMYFL--IGVLCGLAIYNFTIINL-PFPLALFKKLLGKPVDLSDLRQLS 844
            .::.||...:...|  :......:..:||.|.: ||       .:..|:|:.|||:.|
  Fly   463 SSESTFSISSGSSLGSLSTASSKSALSFTDIYIDPF-------AVDSPIDVVDLRRRS 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033 34/157 (22%)
HECTc 739..1059 CDD:214523 26/118 (22%)
kibraNP_001034055.1 WW 57..87 CDD:238122
WW 103..132 CDD:278809
C2_Kibra 693..813 CDD:176062
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.