DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and hyd

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:NP_001287262.1 Gene:hyd / 41181 FlyBaseID:FBgn0002431 Length:2887 Species:Drosophila melanogaster


Alignment Length:282 Identity:80/282 - (28%)
Similarity:130/282 - (46%) Gaps:17/282 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   794 TFETENMYFLIGVLCGLAIYNFTIINLPFPLALFKKLLGKPVDLSDLRQLSPPEANSMQSLLD-- 856
            :||..|.:..||.|.||.:....::.|.....:.|.:||:.:...||....|....|.:.::.  
  Fly  2610 SFERINAFRNIGRLIGLCLLQNELLPLFLQRHVLKYILGRKIKFHDLAFFDPALYESFRQIIQNA 2674

  Fly   857 --YQGDDFKEVFDLTFEISRDVFGE--AETKCLKPNGNEIAVTLENRQEFVDLYVDFVFNKSVEL 917
              .:|::.....:|.|.|  |:..|  ...:.|.|.|.::|||..|..|:|..|.::...||.|.
  Fly  2675 QTKEGEETINRMELCFVI--DLMKEEGCGNRELIPGGRDVAVTSSNIFEYVRRYTEYRLIKSQEK 2737

  Fly   918 HYNAFHKGFMKVCSGRVIHIFQPEELMAVVVGNEDYDWQALQD----NCEYREGYTSVDDTIKWF 978
            ...|...|...|.....:.....|:|..::.|..|.:...|..    |.|..||...:....|||
  Fly  2738 ALEALKDGVFDVLPDNSMINLTAEDLRLLLNGVGDINVSTLISYTTFNDESSEGPDKLLKFKKWF 2802

  Fly   979 WEVIHDMSEAEKKSFLLFLTGSDRIPI--QGMKAL-KLTIQPTPDERFLPVAHTCFNLLDLPRYK 1040
            |.::..|:..|::..:.|.|||..:|.  :|.:.| .:||:|. |:..||.|:||.:.|.:|.|.
  Fly  2803 WSIVEKMNIMERQDLVYFWTGSPALPASEEGFQPLPSVTIRPA-DDSHLPTANTCISRLYIPLYS 2866

  Fly  1041 TKERLKYKLLQAIQQTQGFSLV 1062
            :|..|:.|:|.|| :::.|..|
  Fly  2867 SKSILRSKMLMAI-KSKNFGFV 2887

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033 78/278 (28%)
HECTc 739..1059 CDD:214523 78/277 (28%)
hydNP_001287262.1 E3_UbLigase_EDD 150..196 CDD:288409
ZnF_UBR1 1217..1284 CDD:197698
ASF1_hist_chap 1535..1733 CDD:304562
PolyA 2498..2561 CDD:197769
HECTc 2589..2885 CDD:238033 78/278 (28%)
HECTc 2589..2884 CDD:214523 78/277 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446943
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.