DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and CG3356

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster


Alignment Length:735 Identity:189/735 - (25%)
Similarity:290/735 - (39%) Gaps:159/735 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   457 LDHDRHFGCSVRNHG-LDLKAAQLAFDNLRAVENESIRQVIWDNITKELVGSLVCSPADVESMRL 520
            ||:|....|  |..| |.:|..:...::: |:.||:.|.   |.|.::|      .|....:..:
  Fly   416 LDYDMEQTC--RTSGELSVKERECLLESI-AILNETERV---DFIVQQL------DPHIENTHLI 468

  Fly   521 YLLLPLYHE-FVNSKH----YKSLQV-----PFANAI-FKLAEN--------PRKVLNKWLAQ-- 564
            |.|..:.|. .:.:||    ||.|..     .|..|: ||||..        |..:::|.:..  
  Fly   469 YALCEICHNLMIYNKHAVFEYKLLYTLAFTPKFIRAVWFKLAAESTQLGFSAPLTLISKGVVPKH 533

  Fly   565 --------------------TPAEYFEHLVQNFLHVVIH----------------------IISF 587
                                .|..:....|:|.|.:.:|                      :...
  Fly   534 QGVDRTIPLLATFCMLFGRLLPTLHDVEFVENKLLLQVHSTINHVRLMPFSIAEIIQMSKTLKDI 598

  Fly   588 KMGLA-AASPSAERRQQLLPYNTEL--------------EIILKLMKTLCQINNERHDRLNYQIF 637
            .|||. .|.|  |.|..|..|...|              :|...|:..:..:.|:.|.| :.::.
  Fly   599 SMGLVELAFP--ETRSNLANYRKVLGHTEADDKKLRHQKQIWANLLNVVVFVLNQIHTR-DLRLG 660

  Fly   638 YWP---------DL-----SDYADVQQEYVKWIMA-DTARDFN--------------------IC 667
            :.|         ||     :|........::.|.. ...|||.                    :.
  Fly   661 FCPEDHWTVTRLDLPLDRPTDLPLTHSSRLRGIRPFQPIRDFTREDFENGPPMSTKQIRSITILR 725

  Fly   668 NYSFIFDQSAKTALLQADQALQMHSAMANAATMAFSFFNYGMPISQFIVLNVTRENLVQDSLREL 732
            ...|:...:.:.::||:..|........|     ...|..|    ..:::.|.|.:|.:|:..:|
  Fly   726 EIPFVVPFNKRVSILQSLVAASKMRVQGN-----MQAFLQG----PSVLITVRRSHLYEDAYDKL 781

  Fly   733 QHYSQSDLKKPLKIKFHG-----EEAEDAGGVRKEFFMLLLKDLLDPKYGMF------KEYEQSR 786
            :..::.||:...:|:|..     |...|.|||.:||...|:|...||..|.|      |.|....
  Fly   782 RPDNEPDLRFKFRIQFVSSLGLDEAGIDGGGVFREFLSELIKTAFDPNRGFFMVTTDNKLYPNPN 846

  Fly   787 LLWFADLTFETENMYFLIGVLCGLAIYNFTIINLPFPLALFKKLLGK--PVDLSDLRQLSPPEAN 849
            :   |||..:.|..|:.||.:.|.:||...::.||.......||.||  .||:..|..|.|....
  Fly   847 V---ADLFEDYEKHYYFIGRILGKSIYENLLVELPLAEFFLTKLAGKYSDVDIHQLASLDPELYR 908

  Fly   850 SMQSLLDYQGDDFKEVFDLTFEISRDVFGEAETKCLKPNGNEIAVTLENRQEFVDLYVDFVFNKS 914
            ::..|.||.||  ....:|.|.::....|:.:...|||.|..|.||..||.|::.|..|:..|..
  Fly   909 NLLYLKDYSGD--VSELNLDFTVASSSLGQTQIVELKPQGQSIPVTNSNRIEYLQLIADYKLNVQ 971

  Fly   915 VELHYNAFHKGFMKVCSGRVIHIFQPEELMAVVVGNE-DYDWQALQDNCEYREGYTSVDDTIKWF 978
            :..|.|||.||...|.....:::|..:||..::.|.| ..|.:.|:.:|||...::....:|..|
  Fly   972 IRRHCNAFRKGLSNVLPIEWLYMFSNKELQILISGAEIPIDLEDLKKHCEYGGEFSPEHPSIVTF 1036

  Fly   979 WEVIHDMSEAEKKSFLLFLTGSDRIPIQGMKAL--KLTIQPTPDERFLPVAHTCFNLLDLPRYKT 1041
            |||:....:.:::..|.|:|...|.|:.|.|.|  ...||.|.|...||.|.||.|||.||.:||
  Fly  1037 WEVLEGFDDMQRRQLLKFVTSCSRPPLLGFKDLDPPFFIQNTGDMERLPTASTCTNLLKLPPFKT 1101

  Fly  1042 KERLKYKLLQAIQQTQGFSL 1061
            .|:::.|||.|||...||.|
  Fly  1102 VEQMREKLLYAIQSGAGFEL 1121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033 120/360 (33%)
HECTc 739..1059 CDD:214523 114/335 (34%)
CG3356NP_611896.1 HECTc 766..1120 CDD:238033 120/358 (34%)
HECTc 788..1119 CDD:214523 114/335 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446935
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.