DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and yki

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster


Alignment Length:165 Identity:38/165 - (23%)
Similarity:60/165 - (36%) Gaps:38/165 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 LLIPELQDYVIIQICCGSRHSL-ALSDWGQVLSWGDNDCGQLGHATDKEIVQLPKVVRQLVTKTV 150
            :|.|...:.:::::...:..:| ||.|  .||:.||          .|..:|||..:|:|.....
  Fly    47 MLSPIKSNNLVVRVNQDTDDNLQALFD--SVLNPGD----------AKRPLQLPLRMRKLPNSFF 99

  Fly   151 VQIACGNNHSLALTSCGELYSWGSNIYGQLGVNSPNDLTHCNYPLRLTTLLGIPLAAIACGGNHS 215
            ...|  .:||.| .|....|..||    |..:|..|..:....|...:.:..||...|.....||
  Fly   100 TPPA--PSHSRA-NSADSTYDAGS----QSSINIGNKASIVQQPDGQSPIAAIPQLQIQPSPQHS 157

  Fly   216 FLISKSGAVFGWGRNNCGQLGLNDETNRSYPTQLK 250
                              :|.::....||.|..|:
  Fly   158 ------------------RLAIHHSRARSSPASLQ 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826 3/23 (13%)
RCC1 114..163 CDD:278826 13/48 (27%)
RCC1 167..218 CDD:278826 12/50 (24%)
RCC1 221..270 CDD:278826 5/30 (17%)
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033
HECTc 739..1059 CDD:214523
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354
WW 266..295 CDD:395320
WW 335..364 CDD:395320
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.