DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and Magi

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:NP_001286661.1 Gene:Magi / 37403 FlyBaseID:FBgn0034590 Length:1202 Species:Drosophila melanogaster


Alignment Length:378 Identity:80/378 - (21%)
Similarity:142/378 - (37%) Gaps:86/378 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 QLGHGFSSNEMLPRMVMELMGSTITQVACGNRHTLALVPSRGRVYAFGLGSSGQLGTRSTKSLML 350
            :|.:.|:.|.      .||.|..|        :|..|..|||..:.. :||.|..|....:.|.:
  Fly   428 KLPYKFTRNP------AELQGQRI--------NTTLLKSSRGLGFTI-VGSDGSAGGDVEEFLQI 477

  Fly   351 PQVV-IGP-WVS---PSGSALLQSNDSQV------SLVIRQIFSGGDQSIV---TTTLFVDKVPP 401
            ..|| .|| |:.   .:|..|:..||:.|      .:|  .||    |||:   ...|.|.:..|
  Fly   478 KTVVPNGPAWLDGQLQTGDVLVYVNDTCVLGYTHHDMV--NIF----QSILPGERAALEVCRGYP 536

  Fly   402 EDFRNYNPKSQILTLTA----EVTKQCAQCKQGLQSDMDLLSSIELIFRSQACWNGSFLLDHDRH 462
            ..|...:|.::::|..|    |..||......|..:.:||  |.|...::....:|..|:.....
  Fly   537 LPFDPNDPNTEVVTTMAVDGRESDKQRRLNMDGNYNFLDL--SGEGAKKTSGSGSGFILMKKPEI 599

  Fly   463 FGCSVR--NHGLDLKAAQLAFDNL--RAVENESIRQVIWDNITKELVGSLVCSPADVESMRLYLL 523
            :..|:.  :.|.....|..|...:  :.::.....|::..::..|:.|      .:|.:...:.:
  Fly   600 YTFSIMKGSMGFGFTIADSACGQIVKKILDRNCCTQLMEGDVLLEING------LNVRNKPHFYV 658

  Fly   524 LPLYHEFVNSKHYKSLQVPFANAIFKLAENPRKVLNKWLAQTPAEYFEHLVQNFLHVVIHIISFK 588
            :.|..|.       |...|.|..|.:...:|  ..|..|||             |:.|.::...:
  Fly   659 VELLKEC-------SQTTPTAVKIQRTPPDP--PANNTLAQ-------------LNQVGNVAKLR 701

  Fly   589 MGLAAA------SPSAERRQQLLPYNTELEIILKLMKTLCQINNERHDRLNYQ 635
            .....:      :|:|:.      |:|:::.:|. |:....:.:.|..|:..|
  Fly   702 KNFVGSGLFRSKTPTADL------YSTQVKEVLP-MRPKTPLVDTRRSRVQIQ 747

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826 8/35 (23%)
RCC1_2 309..339 CDD:290274 8/29 (28%)
RCC1 327..390 CDD:278826 21/73 (29%)
HECTc 715..1060 CDD:238033
HECTc 739..1059 CDD:214523
MagiNP_001286661.1 WW 294..323 CDD:278809
WW 342..372 CDD:238122
PDZ 443..534 CDD:214570 29/105 (28%)
DegQ <455..534 CDD:223343 24/85 (28%)
PDZ_signaling 606..668 CDD:238492 10/74 (14%)
PDZ 925..1011 CDD:214570
PDZ_signaling 1029..1110 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.