DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and Hectd1

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:XP_006240148.1 Gene:Hectd1 / 362736 RGDID:1561653 Length:2610 Species:Rattus norvegicus


Alignment Length:488 Identity:109/488 - (22%)
Similarity:174/488 - (35%) Gaps:172/488 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   722 ENLVQDSLRELQHYSQSDLKKPLKIKFHGEEAEDAGGVRKEFFMLLLKDLLDPKYGMFKEYEQSR 786
            ||::|         ..:|.|..|:::|.|||....|.. .||:.|:.           .|::::.
  Rat  2146 ENVMQ---------IHADRKSVLEVEFLGEEGTGLGPT-LEFYALVA-----------AEFQRTD 2189

  Fly   787 L-LWFADLTFETE----------------------------------------NMYFLIGVLCGL 810
            | .|..|..|..:                                        .::..:|:....
  Rat  2190 LGTWLCDDNFPDDESRHVDLGGGLKPPGYYVQRSCGLFTAPFPQDSDELERITKLFHFLGIFLAK 2254

  Fly   811 AIYNFTIINLPFPLALFKKLLGKPV--DLSDL-------RQLSPPEANSMQS------------- 853
            .|.:..:::||.....||.:....:  ::|.|       |.|...|:.|..|             
  Rat  2255 CIQDNRLVDLPISKPFFKLMCMGDIKSNMSKLIYESRGDRDLHCTESQSEASTEEGHDSLSVGSF 2319

  Fly   854 --------LLD---------YQG----DDF-----------KEVFDLTFEISRDVFG-------E 879
                    :||         :.|    :||           ||:.||..: .|.:.|       |
  Rat  2320 EEDSKSEFILDPPKPKPPAWFNGILTWEDFELVNPHRARFLKEIKDLAIK-RRQILGNKSLSEDE 2383

  Fly   880 AETK---------------------------C------------LKPNGNEIAVTLENRQEFVDL 905
            ..||                           |            |||:|.:..:|::|.:|:|||
  Rat  2384 KNTKLQELVLKNPSGSGPPLSIEDLGLNFQFCPSSRIYGFTAVDLKPSGEDEMITMDNAEEYVDL 2448

  Fly   906 YVDFVFNKSVELHYNAFHKGFMKVCSGRVIHIFQPEELMAVVVGNEDYDWQALQDNCEYRE---G 967
            ..||..:..::....||..||.||.....:..|..||:..::.||:...| |.:|...|.|   |
  Rat  2449 MFDFCMHTGIQKQMEAFRDGFNKVFPMEKLSSFSHEEVQMILCGNQSPSW-AAEDIINYTEPKLG 2512

  Fly   968 YTSVDDTIKWFWEVIHDMSEAEKKSFLLFLTGSDRIPIQGMKAL--KLTIQPTPD--ERFLPVAH 1028
            ||........|..|:..||..|:|:||.|.||...:|..|:..|  :||:....|  :...|..:
  Rat  2513 YTRDSPGFLRFVRVLCGMSSDERKAFLQFTTGCSTLPPGGLANLHPRLTVVRKVDATDASYPSVN 2577

  Fly  1029 TCFNLLDLPRYKTKERLKYKLLQAIQQTQGFSL 1061
            ||.:.|.||.|.::|.::.:||.|..: :||.|
  Rat  2578 TCVHYLKLPEYSSEEIMRERLLAATME-KGFHL 2609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033 107/485 (22%)
HECTc 739..1059 CDD:214523 103/467 (22%)
Hectd1XP_006240148.1 Ank_2 366..457 CDD:289560
ANK repeat 366..393 CDD:293786
ANK 369..479 CDD:238125
ANK repeat 396..426 CDD:293786
ANK repeat 428..457 CDD:293786
F5_F8_type_C 1107..1240 CDD:304887
MIB_HERC2 1277..1335 CDD:284184
HECTc 2131..2608 CDD:238033 107/485 (22%)
HECTc 2155..2607 CDD:214523 102/466 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.