DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and Rccd1

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:XP_006229517.1 Gene:Rccd1 / 308760 RGDID:1309901 Length:378 Species:Rattus norvegicus


Alignment Length:315 Identity:79/315 - (25%)
Similarity:123/315 - (39%) Gaps:97/315 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SGKELYCW--GSTSHGQLGLGGIEDEQILTPSQIP-WTPDTAVQQVACGHRHTLFLTATGKVYAC 64
            ||.||..|  ||...|:                 | |     ||.:|.|.:              
  Rat    93 SGTELQAWVPGSALQGE-----------------PLW-----VQNLASGAK-------------- 121

  Fly    65 GSNDYSQLGHDLPTKRPRMSPFLLIPELQDYV---------------IIQICCGSRHSLALSDWG 114
                  ..|.|.|...|||....|:|..:.|:               :.|:..|:.|:|.|.:.|
  Rat   122 ------AQGEDEPGSEPRMGTLPLLPCARAYMTPQPPFCQPLAPELRVRQLQLGAEHALLLCEAG 180

  Fly   115 QVLSWGDNDCGQLGHATDKEIVQLPKVVRQLVTKTVVQIACGNNHSLALTSCGELYSWGSNIYGQ 179
            ||.|||....|||||.:.:..:: |:::..|....:.::|.|..||:.::..|::|.||.|..||
  Rat   181 QVFSWGGGRHGQLGHGSLEAELE-PRLLEALQGLRMAEVAAGGWHSVCVSETGDIYIWGWNESGQ 244

  Fly   180 LGVNSPN---------DLTHCN-------------------------YPLRLTTLLGIPLAAIAC 210
            |.:.:.:         :.|..|                         :|..|...||......:|
  Rat   245 LALPTRSGTEKKTVREEATELNDDGLRGEEAALADVGAPAHFIAIQPFPALLDLPLGSDAVKASC 309

  Fly   211 GGNHSFLISKSGAVFGWGRNNCGQLGLNDETNRSYPTQLKTL--RTLGVRFVACG 263
            |..|:.:::::|.::.||....||||..|.|:...|.:::..  |.|.||.|.||
  Rat   310 GSRHTAVVTRTGELYTWGWGKYGQLGHKDSTSSDQPCRVEYFVERQLEVRAVTCG 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826 12/51 (24%)
RCC1 59..110 CDD:278826 13/65 (20%)
RCC1 114..163 CDD:278826 17/48 (35%)
RCC1 167..218 CDD:278826 17/84 (20%)
RCC1 221..270 CDD:278826 17/45 (38%)
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033
HECTc 739..1059 CDD:214523
Rccd1XP_006229517.1 RCC1_2 163..192 CDD:290274 11/28 (39%)
RCC1 180..228 CDD:278826 17/48 (35%)
RCC1_2 218..244 CDD:290274 9/25 (36%)
RCC1_2 305..333 CDD:290274 6/27 (22%)
RCC1 321..368 CDD:278826 17/44 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.