DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and Wwc1

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:XP_002727807.1 Gene:Wwc1 / 303039 RGDID:1308329 Length:1108 Species:Rattus norvegicus


Alignment Length:101 Identity:19/101 - (18%)
Similarity:45/101 - (44%) Gaps:12/101 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   594 ASPSAERRQQLLPYNTELEIILKLMKTLCQINNERHDRLNYQIFYWPDLSDYADV-----QQEYV 653
            :|..:.|.::|:..:.:||:.|:..:|.       |.:|..:|....:|.::.:.     ::|..
  Rat   970 SSVKSLRTERLIRTSLDLELDLQATRTW-------HSQLTQEISVLKELKEHLEQAKNHGEKELP 1027

  Fly   654 KWIMADTARDFNICNYSFIFDQSAKTALLQADQALQ 689
            :|:..|......:.......|:....:.||||:.::
  Rat  1028 QWLREDERFRLLLRMLEKRVDRGEHKSELQADKMMR 1063

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033
HECTc 739..1059 CDD:214523
Wwc1XP_002727807.1 WW 9..39 CDD:238122
WW 55..84 CDD:278809
ALDH-SF 378..>420 CDD:299846
C2_Kibra 661..784 CDD:176062
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.