DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Herc4 and Bag3

DIOPT Version :9

Sequence 1:	NP_001261249.1	Gene:	Herc4 / 38151	FlyBaseID:	FBgn0035207	Length:	1062	Species:	Drosophila melanogaster
Sequence 2:	NP_038891.4	Gene:	Bag3 / 29810	MGIID:	1352493	Length:	577	Species:	Mus musculus

Alignment Length:	124	Identity:	26/124 - (20%)
Similarity:	38/124 - (30%)	Gaps:	50/124 - (40%)

- Green bases have known domain annotations that are detailed below.

  Fly   878 GEAETKCLKPNGNEIAVTLENRQEFVDLYVDFVFNKSVELHY----------------------- 919
            |||||....|...::...||..|. ::..||....|..:..|
Mouse   416 GEAETPPKHPGVLKVEAILEKVQG-LEQAVDSFEGKKTDKKYLMIEEYLTKELLALDSVDPEGRA 479

  Fly   920 ---NAFHKGFMKV-------------CSGRV-IHIFQP---------EELMAVVVGNED 952
               .|...|..||             ..|:| ::..||         :|:|..||.::|
Mouse   480 DVRQARRDGVRKVQTILEKLEQKAIDVPGQVQVYELQPSNLEAEQPLQEIMGAVVADKD 538

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Herc4	NP_001261249.1	RCC1	6..55	CDD:278826
		RCC1	59..110	CDD:278826
		RCC1	114..163	CDD:278826
		RCC1	167..218	CDD:278826
		RCC1	221..270	CDD:278826
		RCC1	273..322	CDD:278826
		RCC1_2	309..339	CDD:290274
		RCC1	327..390	CDD:278826
		HECTc	715..1060	CDD:238033	26/124 (21%)
		HECTc	739..1059	CDD:214523	26/124 (21%)
Bag3	NP_038891.4	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..81
		WW	23..55	CDD:197736
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	126..207
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	229..427		6/10 (60%)
		BAG	426..503	CDD:214591	11/77 (14%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	524..577		5/15 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5021
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900