DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and Wwp1

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:XP_006237992.1 Gene:Wwp1 / 297930 RGDID:1311734 Length:968 Species:Rattus norvegicus


Alignment Length:371 Identity:114/371 - (30%)
Similarity:191/371 - (51%) Gaps:18/371 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   702 FSFFNYGMPISQFIVLNVTRENLVQDSLRELQHYSQSDLKKPLKIKFHGEEAEDAGGVRKEFFML 766
            |.:......:...:.:||:|:.|.:||.:::......||::.|.:.|.|||..|.||:.:|:|.|
  Rat   600 FRYLCQSNALPSHVKINVSRQTLFEDSFQQIMALKPYDLRRRLYVIFRGEEGLDYGGLAREWFFL 664

  Fly   767 LLKDLLDPKYGMFKEYEQSRLLWFADLTFETEN----MYF-LIGVLCGLAIYNFTIINLPFPLAL 826
            |..::|:|.|.:| ||..............|.|    .|| .||....:|:::...|:..|.|..
  Rat   665 LSHEVLNPMYCLF-EYAGKNNYCLQINPASTINPDHLSYFCFIGRFIAMALFHGKFIDTGFSLPF 728

  Fly   827 FKKLLGKPVDLSDLRQLSPPEANSMQSLLDYQGDDFKEV-FDLTFEISRDVFGEAETKCLKPNGN 890
            :|::|.|.:.:.||..:.....||:..:.|   ::.:|. .::.|.:..::.|:..:..||..|:
  Rat   729 YKRMLSKKLTIKDLESIDTEFYNSLIWIRD---NNIEECGLEMYFSVDMEILGKVTSHDLKLGGS 790

  Fly   891 EIAVTLENRQEFVDLYVDFVFNKSVELHYNAFHKGFMKVCSGRVIHIFQPEELMAVVVGNEDYDW 955
            .|.||.||:.|::.|..::.|::.|:....||..||.:|...:.:..|..:||..::.|.::.|.
  Rat   791 NILVTEENKDEYIGLMTEWRFSRGVQEQTKAFLDGFNEVVPLQWLQYFDEKELEVMLCGMQEVDL 855

  Fly   956 QALQDNCEYREGYTSVDDTIKWFWEVIHDMSEAEKKSFLLFLTGSDRIPIQGMKAL-------KL 1013
            ...|.|..||. ||.....|.|||:.:.:.....:...|.|:||:.|:|:.|...|       |.
  Rat   856 ADWQRNTVYRH-YTRNSKQIIWFWQFVKETDNEVRMRLLQFVTGTCRLPLGGFAELMGSNGPQKF 919

  Fly  1014 TIQPTPDERFLPVAHTCFNLLDLPRYKTKERLKYKLLQAIQQTQGF 1059
            .|:....:.:||.:|||||.||||.||:.|:||.|||.||::|:||
  Rat   920 CIEKVGKDTWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGF 965

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033 113/358 (32%)
HECTc 739..1059 CDD:214523 105/332 (32%)
Wwp1XP_006237992.1 C2_E3_ubiquitin_ligase 67..190 CDD:175988
PARM 243..>400 CDD:293666
WW 397..426 CDD:278809
WW 429..458 CDD:278809
WW 504..533 CDD:278809
WW 545..574 CDD:238122
HECTc 614..966 CDD:238033 113/357 (32%)
HECTc 637..965 CDD:214523 105/332 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.