DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and Wwp2

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:NP_001099654.1 Gene:Wwp2 / 291999 RGDID:1310091 Length:870 Species:Rattus norvegicus


Alignment Length:540 Identity:144/540 - (26%)
Similarity:229/540 - (42%) Gaps:107/540 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   571 EHLVQNFLHVVIHIISFKMGLAAASPSAERRQQLLPYNTELEIILKLMKTLCQINNERHDRLNYQ 635
            :|..|.||:......:....|....|..|:||.                             |.:
  Rat   384 QHFSQRFLYQSSSASTDHDPLGPLPPGWEKRQD-----------------------------NGR 419

  Fly   636 IFY---------WPDLSDYADVQQEYVK--WIMADTARDFNICNYSFIFDQSAKTALLQADQALQ 689
            ::|         |.|......:|:..:.  |.|..|:.     ...:..|.:.:|...: |....
  Rat   420 VYYVNHNTRTTQWEDPRTQGMIQEPALPPGWEMKYTSE-----GVRYFVDHNTRTTTFK-DPRPG 478

  Fly   690 MHSAMANAATMA-----------FSFFNYGMPISQFIVLNVTRENLVQDSLRELQHYSQSDLKKP 743
            ..|.....:..|           |.|..:...:...:.::|:|:.|.:||.:::.:....||::.
  Rat   479 FESGTKQGSPGAYERSFRWKYHQFRFLCHSNALPSHVKISVSRQTLFEDSFQQIMNMKPYDLRRR 543

  Fly   744 LKIKFHGEEAEDAGGVRKEFFMLLLKDLLDPKYGMFKEYEQSRLLWFADLTFETENMYFL----- 803
            |.|...|||..|.||:.:|:|.||..::|:|.|.:|:              :..:|.|.|     
  Rat   544 LYIIMRGEEGLDYGGIAREWFFLLSHEVLNPMYCLFE--------------YAGKNNYCLQINPA 594

  Fly   804 -------------IGVLCGLAIYNFTIINLPFPLALFKKLLGKPVDLSDLRQLSPPEANSM---- 851
                         ||....:|:|:...|:..|.|..:|::|.|...|.||..:.|...||:    
  Rat   595 SSINPDHLTYFRFIGRFIAMALYHGKFIDTGFTLPFYKRMLNKRPTLRDLESIDPEFYNSIIWIK 659

  Fly   852 QSLLDYQGDDFKEVFDLTFEISRDVFGEAETKCLKPNGNEIAVTLENRQEFVDLYVDFVFNKSVE 916
            ::.||..|      .:|.|....::.|:..|..||..|..|.||.||::|::.|..|:.|.:.||
  Rat   660 ENNLDECG------LELFFIQDMEILGKVTTHELKEGGENIRVTEENKEEYIMLLTDWRFTRGVE 718

  Fly   917 LHYNAFHKGFMKVCSGRVIHIFQPEELMAVVVGNEDYDWQALQDNCEYREGYTSVDDTIKWFWEV 981
            ....||..||.:|.....:..|..:||..::.|.::.|....|.|..||. ||.....|:|||:|
  Rat   719 EQTKAFLDGFNEVAPLEWLRYFDEKELELMLCGMQEIDMSDWQKNAIYRH-YTKSSKQIQWFWQV 782

  Fly   982 IHDMSEAEKKSFLLFLTGSDRIPIQGMKAL-------KLTIQPTPDERFLPVAHTCFNLLDLPRY 1039
            :.:|...::...|.|:||:.|:|:.|...|       |..|.....|.:||.:|||||.||||.|
  Rat   783 VKEMDNEKRIRLLQFVTGTCRLPVGGFAELIGSNGPQKFCIDRVGKETWLPRSHTCFNRLDLPPY 847

  Fly  1040 KTKERLKYKLLQAIQQTQGF 1059
            |:.|:||.|||.||::|:||
  Rat   848 KSYEQLKEKLLYAIEETEGF 867

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033 120/374 (32%)
HECTc 739..1059 CDD:214523 113/348 (32%)
Wwp2NP_001099654.1 C2_E3_ubiquitin_ligase 17..142 CDD:175988
WW 302..331 CDD:278809
WW 332..361 CDD:278809
WW 407..435 CDD:278809 7/56 (13%)
WW 447..477 CDD:238122 6/35 (17%)
HECTc 516..868 CDD:238033 120/373 (32%)
HECTc 539..867 CDD:214523 113/348 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.