DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and Nedd4l

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:XP_038952600.1 Gene:Nedd4l / 291553 RGDID:735047 Length:1259 Species:Rattus norvegicus


Alignment Length:358 Identity:126/358 - (35%)
Similarity:198/358 - (55%) Gaps:21/358 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   717 LNVTRENLVQDSLRELQHYSQSD-LKKPLKIKFHGEEAEDAGGVRKEFFMLLLKDLLDPKYGMFK 780
            :.:.|.|:.::|.|.:....:.| ||..|.|:|..|:..|.|||.:|:|.||.|::.:|.||:| 
  Rat   904 MKLHRNNIFEESYRRIMSVKRPDVLKARLWIEFESEKGLDYGGVAREWFFLLSKEMFNPYYGLF- 967

  Fly   781 EYEQS-----RLLWFADLTFETENMYF-LIGVLCGLAIYNFTIINLPFPLALFKKLLGKPVDLSD 839
            ||..:     ::...:.|..|....|| .||.:.|||:::..:::..|....:|.:|||.:.|:|
  Rat   968 EYSATDNYTLQINPNSGLCNEDHLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKMMLGKQITLND 1032

  Fly   840 LRQLSPPEANSMQSLLDYQGDDFKEVFDLTFEISRDVFGEAETKCLKPNGNEIAVTLENRQEFVD 904
            :..:.....||::.:|:   :|..|: ||.|.|..:.||:.....|||||:||.||.||::|::|
  Rat  1033 MESVDSEYYNSLKWILE---NDPTEL-DLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYID 1093

  Fly   905 LYVDFVFNKSVELHYNAFHKGFMKVCSGRVIHIFQPEELMAVVVGNEDYDWQALQDNCEYREGYT 969
            |.:.:.|...|:...|||.:||.::....:|.||...||..::.|..|.|....:.:..|:.||.
  Rat  1094 LVIQWRFVNRVQKQMNAFLEGFTELLPIDLIKIFDENELELLMCGLGDVDVNDWRQHSIYKNGYC 1158

  Fly   970 SVDDTIKWFWEVIHDMSEAEKKSFLL-FLTGSDRIPIQGMKAL-------KLTIQPTPDERFLPV 1026
            .....|:|||:.:. :.:|||:..|| |:||:.|:|:.|...|       ..||:.......||.
  Rat  1159 PNHPVIQWFWKAVL-LMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPEKLPR 1222

  Fly  1027 AHTCFNLLDLPRYKTKERLKYKLLQAIQQTQGF 1059
            ||||||.||||.|:|.|.|:.|||.|::..|||
  Rat  1223 AHTCFNRLDLPPYETFEDLREKLLMAVENAQGF 1255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033 126/358 (35%)
HECTc 739..1059 CDD:214523 120/334 (36%)
Nedd4lXP_038952600.1 C2 <365..418 CDD:417471
WW 463..489 CDD:395320
WW 653..682 CDD:395320
WW 766..796 CDD:238122
WW 815..865 CDD:197736
HECTc 926..1255 CDD:214523 120/334 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.