DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and SPAC10F6.04

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:NP_001342701.1 Gene:SPAC10F6.04 / 2542973 PomBaseID:SPAC10F6.04 Length:351 Species:Schizosaccharomyces pombe


Alignment Length:394 Identity:95/394 - (24%)
Similarity:144/394 - (36%) Gaps:123/394 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GSTSHGQLGLGGIEDEQILTPSQIPWTPDTAVQQVACGHRHTLFLTATGKVYACGSNDYSQLGHD 75
            ||..:.||||.  .||.:.:|..:|:  |.|:::::||..|||.|....:::|||.|...|.|::
pombe     6 GSNGNFQLGLN--NDEDVYSPQIVPF--DRAIEKISCGGNHTLLLDEDSQLWACGDNRKGQCGYE 66

  Fly    76 LPTKRPRMSPFLLIPELQDYVII----------QICCGSRHSLAL-SDWGQVLSWGDNDCGQLG- 128
            :  |.|..:|  |.|   ||:.|          .:.||...|:.: :|..:|.|.|:...|:|| 
pombe    67 V--KEPLYNP--LSP---DYLRIFTRVSHERWVFLTCGWEFSVIVHADRRRVCSCGEGLSGELGQ 124

  Fly   129 ---------------HATDKEIVQLPKVVRQLVTKTVVQIACGNNHSLALTSCGELYSWGSNIYG 178
                           :..|||.              ::.|:.|..|.:.:|:.|.||..|....|
pombe   125 GNRSNSQGLREIDIPYLDDKEF--------------IIDISAGLRHWICVTNEGNLYGCGDGRKG 175

  Fly   179 QLG------VNSPNDLTHCNYPLRLTTLLGIPLAAIACGGNHSFLISKSGAVF------------ 225
            |||      ||..:.|....:           ..|:.||...|.::.::|.|.            
pombe   176 QLGPVVMKTVNKVSFLGRIEH-----------AQAVVCGVQFSAVLQETGHVIVLGGEKWNVAAE 229

  Fly   226 --GWGRNNCGQLGLNDETNRSYPTQLKTLRTLGVRFVACGDEFSVFLTNEGGVFTCGAGAYGQLG 288
              .|..|       |.|.:.|..:......||.:            |:.||.|:..|.....|..
pombe   230 CDAWQAN-------NSELSSSICSISANWSTLSL------------LSTEGCVYAFGRCDRAQKA 275

  Fly   289 HGFSSNEMLPRMVMELMGSTITQVACGNRHTLALVPSRGRVYAFGLGSSGQLG------TRSTKS 347
            |              ...|.|.|:|.|..|.: |...:|.|..:|....|...      ....|:
pombe   276 H--------------TKASDIVQIASGTEHNI-LRTKKGSVLIYGWNEHGNASNDDKRDVYDAKT 325

  Fly   348 LMLP 351
            |.||
pombe   326 LQLP 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826 17/43 (40%)
RCC1 59..110 CDD:278826 17/60 (28%)
RCC1 114..163 CDD:278826 12/64 (19%)
RCC1 167..218 CDD:278826 15/56 (27%)
RCC1 221..270 CDD:278826 9/62 (15%)
RCC1 273..322 CDD:278826 12/48 (25%)
RCC1_2 309..339 CDD:290274 9/29 (31%)
RCC1 327..390 CDD:278826 8/31 (26%)
HECTc 715..1060 CDD:238033
HECTc 739..1059 CDD:214523
SPAC10F6.04NP_001342701.1 ATS1 1..351 CDD:227511 95/394 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.