DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and Plekha5

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:NP_647556.1 Gene:Plekha5 / 246237 RGDID:621175 Length:1281 Species:Rattus norvegicus


Alignment Length:630 Identity:120/630 - (19%)
Similarity:193/630 - (30%) Gaps:237/630 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 DQSIVTTTLFVDKVPPEDFRNYNPKSQILTLTAEVTKQCAQCKQGLQSDMDLLSSIELIFRSQAC 450
            ||::.:.......||...::.::|:.   |..:||:                 |.|:        
  Rat   541 DQTMHSIPTSPSHVPAAAYQGFSPQR---TYRSEVS-----------------SPIQ-------- 577

  Fly   451 WNGSFLLD------HDRHFGCSVRNHGLDLKAAQLAFDNLRAVENESIRQVIWDNITKELVGSLV 509
             .|...:|      |.:|.....|..    ..|.||   |:||..:|:.....:.:|..|: .|.
  Rat   578 -RGDVTIDRRHRPHHPKHVYVPDRRS----MPAGLA---LQAVSPQSLHGRTPEELTLLLI-KLR 633

  Fly   510 CSPADVESMRLYLLLPLY---------------HEFVNSKHYKSLQV----PFANAIFKLAENPR 555
            ...|::.|:|.:.|..|.               |....:..|...|:    |....:..:.||. 
  Rat   634 RQQAELSSIREHTLAQLMQLKLEAHSPKNEILSHHLQRNTIYLDHQMKENEPIITMVHTMIENS- 697

  Fly   556 KVLNKWLAQTPAEYFEHLVQNFLHVVIHIISFKMGLAAASPSAERRQQLLPYN-TELEIILKLMK 619
                   |..|..|.:.|.|          ..|:.|...|.. |.|..|..|. .|::|..||.:
  Rat   698 -------ALRPQLYQQFLRQ----------KNKISLYCLSQD-ECRGTLYKYRPEEVDIDAKLSR 744

  Fly   620 TLCQIN------NERHDRLNYQIFYWPDLSDYADVQQEYV---KWIMADTARDFNICNYSFIFDQ 675
             ||:.:      .|:..:|:               :::|.   ..:.|....:.|..|.:.|   
  Rat   745 -LCEQDKVVRALEEKLQQLH---------------KEKYTLEQALLSASQEIEMNADNPAAI--- 790

  Fly   676 SAKTALLQAD----------QALQMHSAMANAATMAFSFFNYGMPISQFIVLNVTRENLVQDSLR 730
              :|.:||.|          :.|...:|....|...:....|.        :.||| |.:||.|.
  Rat   791 --QTVVLQRDDLQNGLLSTCRELSRATAELERAWREYDKLEYD--------VTVTR-NQMQDQLD 844

  Fly   731 ELQHYSQSDLKKPLKIKFHGEEAEDAGGVRKEFFMLLLKDLLDPKYGMFKEYEQSRLLWFADLTF 795
            .|                 ||...::.|:::......|..:.|...|:.|..:|..       :.
  Rat   845 RL-----------------GEVQSESAGIQRAQIQKELWRIQDVMEGLSKHKQQRG-------SS 885

  Fly   796 ETENMYFLIGVLCGLAIYNFTIINLPFPLALFKK----------LLGKPVDLSDLRQLSPPEANS 850
            ||           |||...      |||...:|.          .|.:..|.::...:.||..:.
  Rat   886 ET-----------GLAGPK------PFPAVKYKSEEEEVVPPRPPLPRSYDFTEQPPIIPPLPSD 933

  Fly   851 MQSLLDYQ-------------------------GDDFK------------EVFDLTFEISRDVFG 878
            ..|||.|.                         |.|::            ||.:...|...:...
  Rat   934 SSSLLCYSRGPVHLPEEKKSHQVQGYPRNGSHCGPDYRLYKSEPELTTVAEVDESNGEEKSEPAS 998

  Fly   879 EAE----------------TKCLKPNGNEIA--VTLENRQEFVDL 905
            |||                ||...|..:.||  |||...::.|:|
  Rat   999 EAEAPVVRGSHFPVGVPLRTKSPTPESSTIASYVTLRKTKKMVEL 1043

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826 2/3 (67%)
HECTc 715..1060 CDD:238033 51/256 (20%)
HECTc 739..1059 CDD:214523 43/232 (19%)
Plekha5NP_647556.1 WW 13..42 CDD:278809
WW 59..88 CDD:278809
PH_PEPP1_2_3 165..268 CDD:270068
PH 171..267 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.