DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and Plekha7

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:XP_017177675.1 Gene:Plekha7 / 233765 MGIID:2445094 Length:1359 Species:Mus musculus


Alignment Length:268 Identity:53/268 - (19%)
Similarity:95/268 - (35%) Gaps:84/268 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   431 LQSDMDLLSSIELIFRSQACWNGSFLLDHDRHF-GCSVRNHGLDLKAAQLAFDNLRAVENESIRQ 494
            ||.....|:|:......|       ||.|...| .|...:..|.|| ..|.:.:|:...||.:..
Mouse   659 LQRHQSKLASVRNFAVGQ-------LLHHYLTFPACQADDTYLQLK-KDLEYLDLKIKNNEPLIN 715

  Fly   495 VIWDNITKELVGSLVCSPADVESMRLYLLLPLYHEFVNSKHYKSLQVPFANAIFKLA-------- 551
            |::..:.|...|   |.|....:.|         :.:..:..|.:::..::...||:        
Mouse   716 VLYKVLKKSARG---CRPGRSMTGR---------DLLKDRSLKPMKIAESDIDVKLSIFCEQDRI 768

  Fly   552 ------------------ENPRKVLNKWLAQ--TPAEYFEHLV--QNFLHV-VIHIISFKMGLAA 593
                              |:..:||::...|  ...::.|.:.  |..|.. ::||         
Mouse   769 LQDLEDKIRALKENKDQLESVLEVLHRQTEQYRDQPQHLEKITCQQRLLQEDLVHI--------- 824

  Fly   594 ASPSAERRQQLLPYNTELE----IILKLMKTLCQIN---NERHDRLNYQIFYWPDLSDYADVQQE 651
                   |.:|...:||:|    ..|||.|.:.|:.   .|:|.|    .|::.:.|   .:|::
Mouse   825 -------RAELCRESTEMENAWNEYLKLEKDVEQLKQTLQEQHRR----AFFFQEKS---QIQKD 875

  Fly   652 YVKWIMAD 659
            .  |.:.|
Mouse   876 L--WRIED 881

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033
HECTc 739..1059 CDD:214523
Plekha7XP_017177675.1 WW 10..39 CDD:366073
WW 55..84 CDD:366073
PH_PEPP1_2_3 158..280 CDD:270068
Smc <692..>894 CDD:224117 43/228 (19%)
PHA03247 <903..1009 CDD:223021
PRK10263 <912..>1118 CDD:236669
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.