DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and HECW1

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:XP_016867371.1 Gene:HECW1 / 23072 HGNCID:22195 Length:1639 Species:Homo sapiens


Alignment Length:371 Identity:114/371 - (30%)
Similarity:184/371 - (49%) Gaps:39/371 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   715 IVLNVTRENLVQDSLRELQHYSQSDLKK-PLKIKFHGEEAEDAGGVRKEFFMLLLKDLLDPKYGM 778
            |.|.:.|::|::.:..::..||:.:|:: .|.:.|.|||..|..|..:|||.||.::|.:|.||:
Human  1283 IKLIIRRDHLLEGTFNQVMAYSRKELQRNKLYVTFVGEEGLDYSGPSREFFFLLSQELFNPYYGL 1347

  Fly   779 FKEYE----------------QSRLLWFADLTFETENMYFLIGVLCGLAIYNFTIINLPFPLALF 827
            | ||.                ::.|.||.           ..|.:.|||:.:..:::..|....:
Human  1348 F-EYSANDTYTVQISPMSAFVENHLEWFR-----------FSGRILGLALIHQYLLDAFFTRPFY 1400

  Fly   828 KKLLGKPVDLSDLRQLSPPEANSMQSLLDYQGDDFKEVFDLTFEISRDVFGEAETKCLKPNGNEI 892
            |.||..|.|||||..|......|:|.:.|   ::..::.||||.::.:|||:...:.||..|...
Human  1401 KALLRLPCDLSDLEYLDEEFHQSLQWMKD---NNITDILDLTFTVNEEVFGQVTERELKSGGANT 1462

  Fly   893 AVTLENRQEFVDLYVDFVFNKSVELHYNAFHKGFMKVCSGRVIHIFQPEELMAVVVGNEDYDWQA 957
            .||.:|::|:::..|.:...:.|.....|..:||.:|...|::.:|...||..|:.|..:.|...
Human  1463 QVTEKNKKEYIERMVKWRVERGVVQQTEALVRGFYEVVDSRLVSVFDARELELVIAGTAEIDLND 1527

  Fly   958 LQDNCEYREGYTSVDDTIKWFWEVIHDMSEAEKKSFLLFLTGSDRIPIQGMKAL-------KLTI 1015
            .::|.|||.||......|:|||..:...:..::...|.|:||:..:|.:|..||       :..|
Human  1528 WRNNTEYRGGYHDGHLVIRWFWAAVERFNNEQRLRLLQFVTGTSSVPYEGFAALRGSNGLRRFCI 1592

  Fly  1016 QPTPDERFLPVAHTCFNLLDLPRYKTKERLKYKLLQAIQQTQGFSL 1061
            :.......||.||||||.||||.|.:...|..|||.|:::|..|.|
Human  1593 EKWGKITSLPRAHTCFNRLDLPPYPSYSMLYEKLLTAVEETSTFGL 1638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033 112/368 (30%)
HECTc 739..1059 CDD:214523 106/343 (31%)
HECW1XP_016867371.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.