DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and Y92H12A.2

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:NP_001293292.1 Gene:Y92H12A.2 / 171719 WormBaseID:WBGene00022358 Length:724 Species:Caenorhabditis elegans


Alignment Length:370 Identity:110/370 - (29%)
Similarity:167/370 - (45%) Gaps:71/370 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   719 VTRENLVQDSLRELQHYSQSDLKKPLKIKFHGEEAEDAGGVRKEFFMLLLKDLLDPKYGMFKEYE 783
            |.|:.|.:||.|.:......||:..|.|:|.||...|.|||.:|:|.||...:.:|.||:| ||.
 Worm   395 VHRDTLFEDSYRHIMDKKDYDLRNKLWIEFFGETGLDYGGVTREWFFLLSHQIFNPYYGLF-EYS 458

  Fly   784 QSRLLWFADLTFETEN-----------------MYF-LIGVLCGLAIYNFTIINLPFPLALFKKL 830
                        .|:|                 .|| .||.:.|:|||:..:::..|....:|.:
 Worm   459 ------------ATDNYTLQINPHSEACNPEHLSYFHFIGRIIGMAIYHGKLLDAFFIRPFYKMM 511

  Fly   831 LGKPVDLSDLRQLSPPEANSMQSLLDYQGDDFKEVFDLTFEISRDVFGEAETKCLKPNGNEIAVT 895
            |||.:.|.|:..:.    |...:.|.|..|:.....:|||.:...:|||.:...|.|||..:.||
 Worm   512 LGKKITLFDMESVD----NEYYNSLIYVKDNDPADLELTFSLDDSIFGETQNIELIPNGANVPVT 572

  Fly   896 LENRQEFVDLYVDFVFNKSVELHYNAFHKGFMKVCSGRVIHIFQPEELMAVVVGNEDY---DWQA 957
            .:|::|:::                       .|....::.:|...||..::.|.:..   ||:|
 Worm   573 EDNKEEYIE-----------------------AVVPSNLLRLFDANELELLMCGLQKIDVKDWKA 614

  Fly   958 LQDNCEYREGYTSVDDTIKWFWEVIHDMSEAEKKSFLLFLTGSDRIPIQGMKAL-------KLTI 1015
               |..|:.||......:..||:.|.......:...|.|::|:.|:|:.|.:.|       |.||
 Worm   615 ---NTIYKGGYGPSSQVVHNFWKCILSFDNEMRARVLQFVSGTSRVPMNGFRELYGSNGLQKFTI 676

  Fly  1016 QPTPDERFLPVAHTCFNLLDLPRYKTKERLKYKLLQAIQQTQGFS 1060
            :.......||.||||||.||||.|.|.:.||.|||.||:.::.||
 Worm   677 ERWGSADMLPRAHTCFNRLDLPPYTTFKELKSKLLTAIENSEIFS 721

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033 108/368 (29%)
HECTc 739..1059 CDD:214523 102/347 (29%)
Y92H12A.2NP_001293292.1 C2 20..147 CDD:301316
WW 170..198 CDD:278809
WW 272..301 CDD:278809
WW 323..353 CDD:197736
HECTc 393..721 CDD:238033 108/368 (29%)
HECTc 415..720 CDD:214523 102/347 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.