DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and wwp-1

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:NP_740775.1 Gene:wwp-1 / 171647 WormBaseID:WBGene00007009 Length:794 Species:Caenorhabditis elegans


Alignment Length:418 Identity:128/418 - (30%)
Similarity:201/418 - (48%) Gaps:38/418 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   671 FIFDQSAKTALLQADQ-----------ALQMHSAMANAATMAFSFFNY---GMPISQFIVLNVTR 721
            |..|..:||......:           .:||  ||..:.....:.|.|   ...:...:.:.|:|
 Worm   383 FFIDHQSKTTTYNDPRTGKPVGPLGVVGVQM--AMEKSFRWKIAQFRYLCLSNSVPNHVKITVSR 445

  Fly   722 ENLVQDSLRELQHYSQSDLKKPLKIKFHGEEAEDAGGVRKEFFMLLLKDLLDPKYGMF-----KE 781
            .|:.:||.:|:...:..||::.|.|:|.|||..|.|||.:|:|.||..::|:|.|.:|     ..
 Worm   446 NNVFEDSFQEIMRKNAVDLRRRLYIQFRGEEGLDYGGVAREWFFLLSHEVLNPMYCLFMYAGNNN 510

  Fly   782 YEQSRLLWFADLTFETEN--MYF-LIGVLCGLAIYNFTIINLPFPLALFKKLLGKPVDLSDLRQL 843
            |.    |.....:|...:  .|| .||....:|:::...|...|.:..:||:|.|.:.|.|:.|:
 Worm   511 YS----LQINPASFVNPDHLKYFEYIGRFIAMALFHGKFIYSGFTMPFYKKMLNKKIVLKDIEQV 571

  Fly   844 SPPEANSMQSLLDYQGDDFKEVFDLTFEISRDVFGEAETKCLKPNGNEIAVTLENRQEFVDLYVD 908
            .....||:..:.|...|:..  .:|.|....::.||.:|..||..|.|||||.||:.|:::|.|:
 Worm   572 DSEIYNSLMWIKDNNIDECD--MELYFVADYELLGELKTYELKEGGTEIAVTEENKLEYIELLVE 634

  Fly   909 FVFNKSVELHYNAFHKGFMKVCSGRVIHIFQPEELMAVVVGNEDYDWQALQDNCEYREGYTSVDD 973
            :.||:.||....||..||..|.....:..|...||..::.|.:|.|....|.|..||. |.....
 Worm   635 WRFNRGVEQQTKAFFTGFNSVFPLEWMQYFDERELELLLCGMQDVDVDDWQRNTVYRH-YAPQSK 698

  Fly   974 TIKWFWEVIHDMSEAEKKSFLLFLTGSDRIPIQGMKALK-------LTIQPTPDERFLPVAHTCF 1031
            .:.|||:.:..:.:.::...|.|:||:.|:|:.|...|.       ..|:....|.:||.:||||
 Worm   699 QVTWFWQWVRSLDQEKRARLLQFVTGTCRVPVGGFSELMGSTGPQLFCIERVGKENWLPRSHTCF 763

  Fly  1032 NLLDLPRYKTKERLKYKLLQAIQQTQGF 1059
            |.||||.|::.::|..||..||:.|:||
 Worm   764 NRLDLPPYRSYDQLVEKLSMAIEMTEGF 791

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033 118/360 (33%)
HECTc 739..1059 CDD:214523 110/334 (33%)
wwp-1NP_740775.1 C2 29..147 CDD:301316
WW 221..250 CDD:278809
WW 255..284 CDD:278809
WW 325..357 CDD:197736
WW 367..398 CDD:197736 4/14 (29%)
HECTc 440..792 CDD:238033 118/359 (33%)
HECTc 463..791 CDD:214523 110/334 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.