DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and Trip12

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:XP_011236956.1 Gene:Trip12 / 14897 MGIID:1309481 Length:2074 Species:Mus musculus


Alignment Length:402 Identity:105/402 - (26%)
Similarity:176/402 - (43%) Gaps:71/402 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   719 VTRENLVQDSLRELQHYSQSDLKKPLKIKFHGEEAEDAGGVRKEFFMLLLKDLLDPKYGMFK--- 780
            |.||.|::.:...:|....|  :..|:|::..|.....|.. .||:.|:.::|......:::   
Mouse  1675 VNREELLKQAESVMQDLGSS--RAMLEIQYENEVGTGLGPT-LEFYALVSQELQRADLCLWRGEE 1736

  Fly   781 -------------EYEQSRLLWFADLTF----------ETENMYFLIGVLCGLAIYNFTIINLPF 822
                         :|.|:....|| |.|          :.:..:..:|.|...||.:|.:::||.
Mouse  1737 VTLSNPKGSQEGTKYIQNLQGLFA-LPFGRTAKPAHIAKVKMKFRFLGKLMAKAIMDFRLVDLPL 1800

  Fly   823 PLALFKKLLGKPVDLS--DLRQLSPPEANSMQSL---------LDYQGDDFKE------------ 864
            .|..:|.:|.:...|:  ||..:.|..|.|:..|         |:......||            
Mouse  1801 GLPFYKWMLRQETSLTSHDLFDIDPVVARSVYHLEDIVRQKKRLEQDKSQTKESLQYALETLTMN 1865

  Fly   865 ---VFDLTFEISRDVFGEAETKCLKPNGNEIAVTLENRQEFVDLYVDFVFNKSVELHYNAFHKGF 926
               |.||..:.:...|...|   ||..|.:|.||:.|.:|::.|.:.:..|:.|...:::|..||
Mouse  1866 GCSVEDLGLDFTLPGFPNIE---LKKGGKDIPVTIHNLEEYLRLVIFWALNEGVCRQFDSFRDGF 1927

  Fly   927 MKVCSGRVIHIFQPEELMAVVVGNEDYDWQA--LQDNCEYREGYTSVDDTIKWFWEVIHDMSEAE 989
            ..|.....:..|.||||..::.|::...|.|  |.:.|....|||.....:|:.:|::......:
Mouse  1928 ESVFPLCHLQYFYPEELDQLLCGSKADTWDAKTLMECCRPDHGYTHDSRAVKFLFEILSSFDNEQ 1992

  Fly   990 KKSFLLFLTGSDRIPIQGMKALK--LTI-------QPTPDERFLPVAHTCFNLLDLPRYKTKERL 1045
            ::.||.|:|||.|:|:.|.::|.  |||       ...||: |||...||.|.|.||.|.:.:.:
Mouse  1993 QRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFESTENPDD-FLPSVMTCVNYLKLPDYSSIDIM 2056

  Fly  1046 KYKLLQAIQQTQ 1057
            :.|||.|.::.|
Mouse  2057 RDKLLIAAREGQ 2068

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033 105/402 (26%)
HECTc 739..1059 CDD:214523 99/382 (26%)
Trip12XP_011236956.1 SRP1 489..>714 CDD:227396
WWE 814..876 CDD:397111
HECTc 1672..2072 CDD:238033 105/402 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.