Sequence 1: | NP_001261249.1 | Gene: | Herc4 / 38151 | FlyBaseID: | FBgn0035207 | Length: | 1062 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006532265.1 | Gene: | Gas7 / 14457 | MGIID: | 1202388 | Length: | 476 | Species: | Mus musculus |
Alignment Length: | 248 | Identity: | 48/248 - (19%) |
---|---|---|---|
Similarity: | 87/248 - (35%) | Gaps: | 91/248 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 648 VQQEYVKWIMADTARDFNICNYSFIFDQSAKTALLQADQAL-----QMHSAMANAATMAFSF--- 704
Fly 705 --FNYGMPISQFIVLNVTRENLVQDSLRELQHY------------------------SQSDLK-- 741
Fly 742 -KPLKIKFHGEEAEDAGGVRKEFF-----MLLLKDLLDPKYGMFKEYEQSRLLWFADLT------ 794
Fly 795 --FETENMYFLIGVLCGLAIYNFTIINLPFPLALFKKLLGKPVDLSDLRQLSP 845 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Herc4 | NP_001261249.1 | RCC1 | 6..55 | CDD:278826 | |
RCC1 | 59..110 | CDD:278826 | |||
RCC1 | 114..163 | CDD:278826 | |||
RCC1 | 167..218 | CDD:278826 | |||
RCC1 | 221..270 | CDD:278826 | |||
RCC1 | 273..322 | CDD:278826 | |||
RCC1_2 | 309..339 | CDD:290274 | |||
RCC1 | 327..390 | CDD:278826 | |||
HECTc | 715..1060 | CDD:238033 | 33/171 (19%) | ||
HECTc | 739..1059 | CDD:214523 | 27/123 (22%) | ||
Gas7 | XP_006532265.1 | SH3_GAS7 | 5..57 | CDD:212763 | |
WW_FCH_linker | 109..201 | CDD:374680 | |||
F-BAR_GAS7 | 214..446 | CDD:153333 | 45/239 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5021 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |