DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and PLEKHA7

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:XP_024304124.1 Gene:PLEKHA7 / 144100 HGNCID:27049 Length:1365 Species:Homo sapiens


Alignment Length:329 Identity:69/329 - (20%)
Similarity:108/329 - (32%) Gaps:103/329 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 GLNDETNR-SYPTQLKTLRTLGVRFVACGDEFSVFLTNEGGVFTCGAGAYGQLGHGFSSNEMLPR 299
            |||.|::: ::|.....|..|     ..||.                    |.|. .|:.|.|.|
Human  1109 GLNAESSKATFPRPKSALERL-----YSGDH--------------------QRGK-MSAEEQLER 1147

  Fly   300 MVMELMGSTITQVACGNRHTLALVPSRGRVYAFGLGSSGQLGTRSTKSLMLP-QVVIGPWVSPSG 363
            |               .||..|||..|.|.    ||...:.|..|::.|..| ...:|.|     
Human  1148 M---------------KRHQKALVRERKRT----LGQGERTGLPSSRYLSRPLPGDLGSW----- 1188

  Fly   364 SALLQSNDSQVSLVIRQIFSGGDQSIVTTTLFVDKVPPEDFRNYNPKSQILTLTAEVTK--QCAQ 426
               .:..|..:.|:.|.:............|.|..:|..:. :..|:...|.::.|::|  :.:.
Human  1189 ---KREQDFDLQLLERVVQGEKKDKEENGWLKVQAMPVTEL-DLEPQDYDLDISRELSKPEKVSI 1249

  Fly   427 CKQGLQSDMDLLSSIE--------------LIFRSQACWNGSFLLDHDRHFGCSVRNHGLDLKAA 477
            .::.::.|.:...|:|              ::.||..| |.......|       :|...||   
Human  1250 PERYVELDPEEPPSLEELQARYRKAEKIRNILARSSMC-NLQPTSGQD-------QNSVADL--- 1303

  Fly   478 QLAFDNLRAVENESIRQVIWDNITKELVGSLVCSPADVESMRLYLL----------LPLYHEFVN 532
                 :|:..|.|.|     .||:..|..........|.:.:|.||          :|.|..|.|
Human  1304 -----DLQLQEQERI-----INISYALASEASQRSKQVAAQQLALLPPKGPLSSRTVPPYPPFTN 1358

  Fly   533 SKHY 536
            ..||
Human  1359 GLHY 1362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826 9/34 (26%)
RCC1 273..322 CDD:278826 9/48 (19%)
RCC1_2 309..339 CDD:290274 9/29 (31%)
RCC1 327..390 CDD:278826 12/63 (19%)
HECTc 715..1060 CDD:238033
HECTc 739..1059 CDD:214523
PLEKHA7XP_024304124.1 WW 11..40 CDD:306827
WW 56..85 CDD:306827
PH_PEPP1_2_3 159..281 CDD:270068
NESP55 <299..460 CDD:115071
DUF1640 779..905 CDD:311647
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.