DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and WWP2

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:NP_001257383.1 Gene:WWP2 / 11060 HGNCID:16804 Length:870 Species:Homo sapiens


Alignment Length:537 Identity:140/537 - (26%)
Similarity:230/537 - (42%) Gaps:101/537 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   571 EHLVQNFLHVVIHIISFKMGLAAASPSAERRQQLLPYNTELEIILKLMKTLCQINNERHDRLNYQ 635
            :|..|.||:......:....|....|..|:||.                             |.:
Human   384 QHFSQRFLYQSSSASTDHDPLGPLPPGWEKRQD-----------------------------NGR 419

  Fly   636 IFY---------WPDLSDYADVQQEYVK--WIMADTARDFNICNYSFIFDQSAKTALLQADQALQ 689
            ::|         |.|......:|:..:.  |.|..|:.     ...:..|.:.:|...: |....
Human   420 VYYVNHNTRTTQWEDPRTQGMIQEPALPPGWEMKYTSE-----GVRYFVDHNTRTTTFK-DPRPG 478

  Fly   690 MHSAMANAATMA-----------FSFFNYGMPISQFIVLNVTRENLVQDSLRELQHYSQSDLKKP 743
            ..|.....:..|           |.|..:...:...:.::|:|:.|.:||.:::.:....||::.
Human   479 FESGTKQGSPGAYDRSFRWKYHQFRFLCHSNALPSHVKISVSRQTLFEDSFQQIMNMKPYDLRRR 543

  Fly   744 LKIKFHGEEAEDAGGVRKEFFMLLLKDLLDPKYGMFKEYEQSRLLWFADLTFETENMYFL----- 803
            |.|...|||..|.||:.:|:|.||..::|:|.|.:|:              :..:|.|.|     
Human   544 LYIIMRGEEGLDYGGIAREWFFLLSHEVLNPMYCLFE--------------YAGKNNYCLQINPA 594

  Fly   804 -------------IGVLCGLAIYNFTIINLPFPLALFKKLLGKPVDLSDLRQLSPPEANSMQSLL 855
                         ||....:|:|:...|:..|.|..:|::|.|...|.||..:.|...||:..:.
Human   595 SSINPDHLTYFRFIGRFIAMALYHGKFIDTGFTLPFYKRMLNKRPTLKDLESIDPEFYNSIVWIK 659

  Fly   856 DYQGDDFKEV-FDLTFEISRDVFGEAETKCLKPNGNEIAVTLENRQEFVDLYVDFVFNKSVELHY 919
            :   ::.:|. .:|.|....::.|:..|..||..|..|.||.||::|::.|..|:.|.:.||...
Human   660 E---NNLEECGLELYFIQDMEILGKVTTHELKEGGESIRVTEENKEEYIMLLTDWRFTRGVEEQT 721

  Fly   920 NAFHKGFMKVCSGRVIHIFQPEELMAVVVGNEDYDWQALQDNCEYREGYTSVDDTIKWFWEVIHD 984
            .||..||.:|.....:..|..:||..::.|.::.|....|.:..||. ||.....|:|||:|:.:
Human   722 KAFLDGFNEVAPLEWLRYFDEKELELMLCGMQEIDMSDWQKSTIYRH-YTKNSKQIQWFWQVVKE 785

  Fly   985 MSEAEKKSFLLFLTGSDRIPIQGMKAL-------KLTIQPTPDERFLPVAHTCFNLLDLPRYKTK 1042
            |...::...|.|:||:.|:|:.|...|       |..|.....|.:||.:|||||.||||.||:.
Human   786 MDNEKRIRLLQFVTGTCRLPVGGFAELIGSNGPQKFCIDKVGKETWLPRSHTCFNRLDLPPYKSY 850

  Fly  1043 ERLKYKLLQAIQQTQGF 1059
            |:|:.|||.||::|:||
Human   851 EQLREKLLYAIEETEGF 867

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033 116/371 (31%)
HECTc 739..1059 CDD:214523 109/345 (32%)
WWP2NP_001257383.1 C2_E3_ubiquitin_ligase 17..142 CDD:175988
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..299
Atrophin-1 <164..343 CDD:331285
WW 302..331 CDD:306827
WW 332..361 CDD:306827
WW 407..435 CDD:306827 7/56 (13%)
WW 447..477 CDD:238122 6/35 (17%)
HECTc 516..868 CDD:238033 116/370 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.