DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and WWP1

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:NP_008944.1 Gene:WWP1 / 11059 HGNCID:17004 Length:922 Species:Homo sapiens


Alignment Length:371 Identity:114/371 - (30%)
Similarity:191/371 - (51%) Gaps:18/371 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   702 FSFFNYGMPISQFIVLNVTRENLVQDSLRELQHYSQSDLKKPLKIKFHGEEAEDAGGVRKEFFML 766
            |.:......:...:.:||:|:.|.:||.:::......||::.|.:.|.|||..|.||:.:|:|.|
Human   554 FRYLCQSNALPSHVKINVSRQTLFEDSFQQIMALKPYDLRRRLYVIFRGEEGLDYGGLAREWFFL 618

  Fly   767 LLKDLLDPKYGMFKEYEQSRLLWFADLTFETEN----MYF-LIGVLCGLAIYNFTIINLPFPLAL 826
            |..::|:|.|.:| ||..............|.|    .|| .||....:|:::...|:..|.|..
Human   619 LSHEVLNPMYCLF-EYAGKNNYCLQINPASTINPDHLSYFCFIGRFIAMALFHGKFIDTGFSLPF 682

  Fly   827 FKKLLGKPVDLSDLRQLSPPEANSMQSLLDYQGDDFKEV-FDLTFEISRDVFGEAETKCLKPNGN 890
            :|::|.|.:.:.||..:.....||:..:.|   ::.:|. .::.|.:..::.|:..:..||..|:
Human   683 YKRMLSKKLTIKDLESIDTEFYNSLIWIRD---NNIEECGLEMYFSVDMEILGKVTSHDLKLGGS 744

  Fly   891 EIAVTLENRQEFVDLYVDFVFNKSVELHYNAFHKGFMKVCSGRVIHIFQPEELMAVVVGNEDYDW 955
            .|.||.||:.|::.|..::.|::.|:....||..||.:|...:.:..|..:||..::.|.::.|.
Human   745 NILVTEENKDEYIGLMTEWRFSRGVQEQTKAFLDGFNEVVPLQWLQYFDEKELEVMLCGMQEVDL 809

  Fly   956 QALQDNCEYREGYTSVDDTIKWFWEVIHDMSEAEKKSFLLFLTGSDRIPIQGMKAL-------KL 1013
            ...|.|..||. ||.....|.|||:.:.:.....:...|.|:||:.|:|:.|...|       |.
Human   810 ADWQRNTVYRH-YTRNSKQIIWFWQFVKETDNEVRMRLLQFVTGTCRLPLGGFAELMGSNGPQKF 873

  Fly  1014 TIQPTPDERFLPVAHTCFNLLDLPRYKTKERLKYKLLQAIQQTQGF 1059
            .|:....:.:||.:|||||.||||.||:.|:||.|||.||::|:||
Human   874 CIEKVGKDTWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGF 919

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826
RCC1 59..110 CDD:278826
RCC1 114..163 CDD:278826
RCC1 167..218 CDD:278826
RCC1 221..270 CDD:278826
RCC1 273..322 CDD:278826
RCC1_2 309..339 CDD:290274
RCC1 327..390 CDD:278826
HECTc 715..1060 CDD:238033 113/358 (32%)
HECTc 739..1059 CDD:214523 105/332 (32%)
WWP1NP_008944.1 C2_E3_ubiquitin_ligase 17..140 CDD:175988
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..388
HUL4 <307..922 CDD:227354 114/371 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.