DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Herc4 and Rcc1

DIOPT Version :9

Sequence 1:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster
Sequence 2:NP_001184011.1 Gene:Rcc1 / 100088 MGIID:1913989 Length:434 Species:Mus musculus


Alignment Length:404 Identity:123/404 - (30%)
Similarity:192/404 - (47%) Gaps:55/404 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GSTSHGQLGLGGIEDEQIL---TPSQIPWTPDTAVQQVACGHRHTLFLTATGKVYACGSNDYSQL 72
            |....||||||    |.:|   .|:.:|...|  |.|...|..||:.|:.:|:||:.|.||...|
Mouse    54 GQGDVGQLGLG----ESVLERKKPALVPLLQD--VVQAEAGGMHTVCL
SQSGQVYSFGCNDEGAL 112

  Fly    73 GHDLPTKRPRMSPFLLIPELQDYVIIQICCGSRHSLALSDWGQVLSWG---DNDCGQLGHATDKE 134
            |.|...:...|.|..:  |||:.| :|:..|..|:.||::.|:|..||   ||: |.:|.....:
Mouse   113 GRDTSVEGSEMVPGKV--ELQEKV-VQVSAGDSHTAAL
TEDGRVFLWGSFRDNN-GVIGLLEPMK 173

  Fly   135 IVQLPKVVRQLVTKTVVQIACGNNHSLALTSCGELYSWGSNIYGQLGVNSPNDLTHCNYPLRLTT 199
            ...:|  |:..:...||::|.||:|.:.||:.|:||:.|....|||| ..|....:......|..
Mouse   174 KSMVP--VQVQLDAPVVKVASGNDHLVMLTNDGDLYTLGCGEQGQLG-RVPELFANRGGRQGLGR 235

  Fly   200 LLGIPLAAIA---------------CGGNHSFLISKSGAVFGWGRNNCGQLGLNDETNRSYPTQL 249
            || :|...:.               ||...:|.||:.|.|:|:|.:|..|||.....:...|..|
Mouse   236 LL-VPRCVLLKSRGTRGRVRFQDAFCGAYFTFAI
SREGHVYGFGLSNYHQLGTPGTGSCFIPQNL 299

  Fly   250 KTLRTLGVRFV--ACGDEFSVFLTNEGGVFTCGAGAYGQLGHGFSSNE-MLPRMVMELMGSTITQ 311
            .:.:.....:|  :.|...:|.:.:||..::.|...||:||.|..:.| .:|.::..|  ..::.
Mouse   300 TSFKNSTKSWVGFSGGQHHTVCM
DSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRL--PVVSS 362

  Fly   312 VACGNRHTLALVPSRGRVYAFGLGSSGQLGTRSTKSLMLPQVVIGPWVSPSGSALLQSNDSQVSL 376
            ||||.....| |...|||:|:|:|::.||||...:....|       |..:|..|    :::|.|
Mouse   363 VACGASVGYA-VSKDGRVFAWGMGTNYQLGTGQDEDAWSP-------VEMTGKQL----ENRVVL 415

  Fly   377 VIRQIFSGGDQSIV 390
            .:.   |||..:::
Mouse   416 TVS---SGGQHTVL 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Herc4NP_001261249.1 RCC1 6..55 CDD:278826 17/46 (37%)
RCC1 59..110 CDD:278826 18/50 (36%)
RCC1 114..163 CDD:278826 16/51 (31%)
RCC1 167..218 CDD:278826 16/65 (25%)
RCC1 221..270 CDD:278826 13/50 (26%)
RCC1 273..322 CDD:278826 15/49 (31%)
RCC1_2 309..339 CDD:290274 12/29 (41%)
RCC1 327..390 CDD:278826 19/62 (31%)
HECTc 715..1060 CDD:238033
HECTc 739..1059 CDD:214523
Rcc1NP_001184011.1 RCC1 48..95 CDD:278826 17/46 (37%)
RCC1 98..147 CDD:278826 18/51 (35%)
RCC1 150..200 CDD:278826 16/52 (31%)
RCC1_2 187..216 CDD:290274 12/28 (43%)
RCC1 203..268 CDD:278826 16/66 (24%)
RCC1 271..322 CDD:278826 13/50 (26%)
RCC1 325..368 CDD:278826 15/44 (34%)
RCC1 376..427 CDD:278826 19/65 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.