DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sturkopf and F11C1.4

DIOPT Version :9

Sequence 1:NP_612097.1 Gene:sturkopf / 38150 FlyBaseID:FBgn0035206 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_510156.2 Gene:F11C1.4 / 184342 WormBaseID:WBGene00008693 Length:301 Species:Caenorhabditis elegans


Alignment Length:293 Identity:84/293 - (28%)
Similarity:139/293 - (47%) Gaps:42/293 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ITGNPGLPGFYTEFAGTL-------QKELGDLPV----WVIGHAGHDDPPEASIREVPQLSGNEE 88
            :.||||..||||:|...|       ::.||...|    :.:.|..|...| .|:|.......||.
 Worm    24 VLGNPGNDGFYTDFGRRLIRNLIAREERLGTRRVQFVFYTLSHLNHVLLP-TSLRCSESHKVNER 87

  Fly    89 LFNLDGQIRHKIAFIEKYVPSDVKIHLIGHSIGAWMILQLLENERIRSRIQKCYMLFPTVERMME 153
             |:|..|::||:.|:::|:|...::::.||..||:|:|.:|...:....::|...||||:|||.|
 Worm    88 -FSLADQVQHKLDFVKEYLPRGNRVYMFGHGDGAYMLLSILPYIKDDFNLRKAVCLFPTIERMTE 151

  Fly   154 SPNGWVFTKVAMPLYSVFGYIFFSFFNFLPVWL-RLMLIQIYFLIFSIPRQFLGTAL--KYSKP- 214
            |.:|....||...|..             ..|| |.:...:..:..|:.|:.:...|  :.|.| 
 Worm   152 SNHGIRLRKVVSTLRQ-------------NDWLARTLSFWVDLMPESLKRKIISMKLSSEQSSPE 203

  Fly   215 ---SVAE--------KVVFLADDEMARVRGIQREIVEQNLDLLKFYYGTTDGWVPISYYDQLKKD 268
               |::|        .:|.|.:||:.:: |...|.:..:.:|:.||||..|||.||...:|:.:.
 Worm   204 LMDSISELLHMHVFRNIVHLCNDELDKI-GTLDETLLFHKNLIYFYYGVNDGWCPIEQGNQMSER 267

  Fly   269 YPKVDAQLDTKKIDHAFVLRHSQPMAVIVRDMI 301
            ..:....:|...::|:|:.|.:..||..|...|
 Worm   268 LSRGHVVIDQNTVEHSFMFRDAATMAEKVLQFI 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sturkopfNP_612097.1 MhpC 4..304 CDD:223669 84/293 (29%)
DUF2305 28..286 CDD:287232 78/276 (28%)
F11C1.4NP_510156.2 Abhydrolase 26..284 CDD:304388 78/273 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167078
Domainoid 1 1.000 106 1.000 Domainoid score I4110
eggNOG 1 0.900 - - E1_KOG3975
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41453
Inparanoid 1 1.050 111 1.000 Inparanoid score I3444
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53946
OrthoDB 1 1.010 - - D1163030at2759
OrthoFinder 1 1.000 - - FOG0004310
OrthoInspector 1 1.000 - - otm14153
orthoMCL 1 0.900 - - OOG6_103147
Panther 1 1.100 - - O PTHR13390
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2370
SonicParanoid 1 1.000 - - X4098
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.