DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sturkopf and F11C1.10

DIOPT Version :9

Sequence 1:NP_612097.1 Gene:sturkopf / 38150 FlyBaseID:FBgn0035206 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001379522.1 Gene:F11C1.10 / 13223340 WormBaseID:WBGene00195214 Length:89 Species:Caenorhabditis elegans


Alignment Length:53 Identity:13/53 - (24%)
Similarity:23/53 - (43%) Gaps:14/53 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 LKYSKPSVAEKVVFLADDEMARVRGIQREI-VEQNLDLLKFYYGTTDGWVPIS 260
            :.:||.:..:.  |..|....||||....| :::|::           ||.:|
 Worm     1 MSFSKENEIDS--FPIDRVTGRVRGSVNMIDIQRNVE-----------WVEVS 40

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sturkopfNP_612097.1 MhpC 4..304 CDD:223669 13/53 (25%)
DUF2305 28..286 CDD:287232 13/53 (25%)
F11C1.10NP_001379522.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1163030at2759
OrthoFinder 1 1.000 - - FOG0004310
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.