powered by:
Protein Alignment sturkopf and F11C1.10
DIOPT Version :9
Sequence 1: | NP_612097.1 |
Gene: | sturkopf / 38150 |
FlyBaseID: | FBgn0035206 |
Length: | 307 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001379522.1 |
Gene: | F11C1.10 / 13223340 |
WormBaseID: | WBGene00195214 |
Length: | 89 |
Species: | Caenorhabditis elegans |
Alignment Length: | 53 |
Identity: | 13/53 - (24%) |
Similarity: | 23/53 - (43%) |
Gaps: | 14/53 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 209 LKYSKPSVAEKVVFLADDEMARVRGIQREI-VEQNLDLLKFYYGTTDGWVPIS 260
:.:||.:..:. |..|....||||....| :::|:: ||.:|
Worm 1 MSFSKENEIDS--FPIDRVTGRVRGSVNMIDIQRNVE-----------WVEVS 40
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
sturkopf | NP_612097.1 |
MhpC |
4..304 |
CDD:223669 |
13/53 (25%) |
DUF2305 |
28..286 |
CDD:287232 |
13/53 (25%) |
F11C1.10 | NP_001379522.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1163030at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0004310 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.