DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KIT and drpr

DIOPT Version :9

Sequence 1:NP_001372213.1 Gene:KIT / 3815 HGNCID:6342 Length:977 Species:Homo sapiens
Sequence 2:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster


Alignment Length:178 Identity:33/178 - (18%)
Similarity:59/178 - (33%) Gaps:66/178 - (37%)


- Green bases have known domain annotations that are detailed below.


Human    43 KSDLIVRVGDEIRLLCTDPG-----FVKWTFEIL------DETNENKQNEWITEKAEATNTGKYT 96
            :|.:....||:    |...|     .:.:..::|      |.||....||.:.|:.....     
  Fly   881 RSTMSTDYGDD----CNASGRVGSYSINYNHDLLTKNLNADRTNPIVYNESLKEEHVYDE----- 936

Human    97 CTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLR 161
            ..:|.|        .:||.|::  .:.|:.:::.|.|           :||......||      
  Fly   937 IKHKEG--------YKDPVKIY--SKILFPEDEYDHL-----------DYSRPSTSQKP------ 974

Human   162 FIPDPKAGIMIKSVKRAYHRL---CLHCSVDQEGKSVLSEKFILKVRP 206
                            .|||:   .|:.:.|:|..|.:....:|..:|
  Fly   975 ----------------HYHRMNDAMLNINQDEEKPSNVKNMTVLLNKP 1006

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KITNP_001372213.1 Ig strand A 212..215 CDD:409353
ig 216..306 CDD:395002
Ig strand B 229..239 CDD:409353
Ig strand C' 250..252 CDD:409353
Ig strand D 260..263 CDD:409353
Ig strand E 267..280 CDD:409353
Ig strand F 287..294 CDD:409353
Ig strand G 300..308 CDD:409353
IgI_4_SCFR 312..412 CDD:409446
Ig strand B 332..336 CDD:409446
Ig strand C 346..350 CDD:409446
Ig strand E 376..380 CDD:409446
Ig strand F 390..395 CDD:409446
Ig strand G 403..406 CDD:409446
Ig 427..503 CDD:409353
Ig strand C 438..442 CDD:409353
Ig strand E 471..479 CDD:409353
Ig strand F 489..494 CDD:409353
PTKc_Kit 554..929 CDD:270682
Important for interaction with phosphotyrosine-binding proteins 569..571
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.