DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9149 and ERG10

DIOPT Version :9

Sequence 1:NP_612094.2 Gene:CG9149 / 38147 FlyBaseID:FBgn0035203 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_015297.1 Gene:ERG10 / 856079 SGDID:S000005949 Length:398 Species:Saccharomyces cerevisiae


Alignment Length:400 Identity:178/400 - (44%)
Similarity:252/400 - (63%) Gaps:16/400 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DVFIVSAARTPIGSFNGTLSKLKASDLGSVVIQEVLRRANV--EGQEVNEVILGQALSAGQGQNP 65
            :|:|||.||||||||.|:||...|.:||:|.::..|.:...  ..::.:|:|.|..|||..||.|
Yeast     4 NVYIVSTARTPIGSFQGSLSSKTAVELGAVALKGALAKVPELDASKDFDEIIFGNVLSANLGQAP 68

  Fly    66 ARQASLKAGLPIQVPAYGINMLCGSGLKTVALGYQAIRSGDAQIVVAGGQESMSLAPHVM-HLRQ 129
            |||.:|.|||...:.|..:|.:|.|.:|.:.||.|:|:.|:|.:|||||.|||:.||:.| ..|.
Yeast    69 ARQVALAAGLSNHIVASTVNKVCASAMKAIILGAQSIKCGNADVVVAGGCESMTNAPYYMPAARA 133

  Fly   130 GVKMGPGTMVDSMIHDGLTDAMENIHMGITAENLADKYNISREAQDAYAVLSQNRAEEAQKKGYF 194
            |.|.|...:||.:..|||.||.:.:.||:.||..|..::|:||.||.:|:.|..:::::||:|.|
Yeast   134 GAKFGQTVLVDGVERDGLNDAYDGLAMGVHAEKCARDWDITREQQDNFAIESYQKSQKSQKEGKF 198

  Fly   195 DKEIVPVEIKDRKG--TTTFSKDEYIKAGSTVEGIQKLRAAF-KEGGSITAGNASGVNDSAAAVL 256
            |.|||||.||..:|  .|..:|||. .|...||.::..|..| ||.|::||.|||.:||.||||:
Yeast   199 DNEIVPVTIKGFRGKPDTQVTKDEE-PARLHVEKLRSARTVFQKENGTVTAANASPINDGAAAVI 262

  Fly   257 LMSGEEVARKGLKPLARIVGWTQSGIEPKVMGLGPVTAV-----EALLQKINWKREEVDLYELNE 316
            |:|.:.:..|.|||||.|.||.::..:|......|..||     .|.::.||    .||.:|.||
Yeast   263 LVSEKVLKEKNLKPLAIIKGWGEAAHQPADFTWAPSLAVPKALKHAGIEDIN----SVDYFEFNE 323

  Fly   317 AFAAQSLAVLQDLQLDAQKVNVNGGAIALGHPIGASGARVLVTLLYALERTGGRKGIASLCIGGG 381
            ||:...|...:.|:||..||||.|||:|||||:|.|||||:||||..|::.||:.|:|::|.|||
Yeast   324 AFSVVGLVNTKILKLDPSKVNVYGGAVALGHPLGCSGARVVVTLLSILQQEGGKIGVAAICNGGG 388

  Fly   382 MGIALAVERL 391
            ...::.:|::
Yeast   389 GASSIVIEKI 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9149NP_612094.2 PRK05790 1..391 CDD:180261 178/398 (45%)
thiolase 5..390 CDD:238383 176/395 (45%)
ERG10NP_015297.1 PLN02644 4..396 CDD:215347 177/396 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60894
OrthoFinder 1 1.000 - - FOG0000432
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100472
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.680

Return to query results.
Submit another query.