DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9149 and POT1

DIOPT Version :9

Sequence 1:NP_612094.2 Gene:CG9149 / 38147 FlyBaseID:FBgn0035203 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_012106.1 Gene:POT1 / 854646 SGDID:S000001422 Length:417 Species:Saccharomyces cerevisiae


Alignment Length:396 Identity:140/396 - (35%)
Similarity:207/396 - (52%) Gaps:32/396 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DVFIVSAARTPIG-SFNGTLSKLKASDLGSVVIQEVLRR----ANVEGQEVNEVILGQALSAGQG 62
            ||.||:|.|:.|| .|.|....:....|....:.|.:.|    ...:...:.||..|..|:.|.|
Yeast    35 DVVIVAANRSAIGKGFKGAFKDVNTDYLLYNFLNEFIGRFPEPLRADLNLIEEVACGNVLNVGAG 99

  Fly    63 QNPARQASLKAGLPIQVPAYGINMLCGSGLKTVALGYQAIRSGDAQIVVAGGQESMSLAPHVMHL 127
            ....|.|.|.:|:|...|...:|..|.|||..|......|:.|...|.:|.|.|||:        
Yeast   100 ATEHRAACLASGIPYSTPFVALNRQCSSGLTAVNDIANKIKVGQIDIGLALGVESMT-------- 156

  Fly   128 RQGVKMGPGTMVDSMIHDGLTDAMEN-------IHMGITAENLADKYNISREAQDAYAVLSQNRA 185
            .....:.|..|:.|      .:..:|       |.||||.||:|..:.|||:.||.:|..|..:|
Yeast   157 NNYKNVNPLGMISS------EELQKNREAKKCLIPMGITNENVAANFKISRKDQDEFAANSYQKA 215

  Fly   186 EEAQKKGYFDKEIVPVEIKDRKGTTTFSKDEYIKAGSTVEGIQKLRAAF-KEGGSITAGNASGVN 249
            .:|:.:|.|:.||:|:::.|  |:...| ||..:...|.|.:..:|.|| |:.|:.||||||.|:
Yeast   216 YKAKNEGLFEDEILPIKLPD--GSICQS-DEGPRPNVTAESLSSIRPAFIKDRGTTTAGNASQVS 277

  Fly   250 DSAAAVLLMSGEEVARKGLKPLARIVGWTQSGIEPKVMGLGPVTAVEALLQKINWKREEVDLYEL 314
            |..|.|||.......:..|..|.|.:.:...|:.|::||:||..|:..:|:....:.:::|::|:
Yeast   278 DGVAGVLLARRSVANQLNLPVLGRYIDFQTVGVPPEIMGVGPAYAIPKVLEATGLQVQDIDIFEI 342

  Fly   315 NEAFAAQSLAVLQDLQLDAQKVNVNGGAIALGHPIGASGARVLVTLLYALERTGGRKGIASLCIG 379
            |||||||:|..:..|.:|..|||..|||||||||:|.:|||.:.|:|..|::  .:.|:.|:|||
Yeast   343 NEAFAAQALYCIHKLGIDLNKVNPRGGAIALGHPLGCTGARQVATILRELKK--DQIGVVSMCIG 405

  Fly   380 GGMGIA 385
            .|||.|
Yeast   406 TGMGAA 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9149NP_612094.2 PRK05790 1..391 CDD:180261 140/396 (35%)
thiolase 5..390 CDD:238383 138/394 (35%)
POT1NP_012106.1 thiolase 37..414 CDD:238383 138/394 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I1282
eggNOG 1 0.900 - - E1_COG0183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.