DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9149 and PKT4

DIOPT Version :9

Sequence 1:NP_612094.2 Gene:CG9149 / 38147 FlyBaseID:FBgn0035203 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_171965.1 Gene:PKT4 / 839434 AraportID:AT1G04710 Length:443 Species:Arabidopsis thaliana


Alignment Length:406 Identity:162/406 - (39%)
Similarity:230/406 - (56%) Gaps:36/406 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DVFIVSAARTPI-----GSFNGTL-SKLKASDLGSVVIQEVLRRANVEGQEVNEVILGQALSAG- 60
            ||.||:|.||.:     |||..|. .:|.||     |::.::.:.||...||.::::|..|..| 
plant    43 DVVIVAAQRTALCKAKRGSFKDTFPDELLAS-----VLRALIEKTNVNPSEVGDIVVGTVLGPGS 102

  Fly    61 QGQNPARQASLKAGLPIQVPAYGINMLCGSGLKTVALGYQAIRSGDAQIVVAGGQESMSLAPHVM 125
            |..:..|.|:..||.|..||...:|..|.|||:.||....||::|...|.:..|.|||:..|   
plant   103 QRASECRMAAFYAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNP--- 164

  Fly   126 HLRQGVK--MGPGTMVDSMIHDGLTDAMENIHMGITAENLADKYNISREAQDAYAVLSQNRAEEA 188
               :|.|  :.|........|:.|      :.||||:||:|.::|:|||.||..||.|..:|..|
plant   165 ---RGWKGSVNPNVKKFEQAHNCL------LPMGITSENVAHRFNVSREEQDQAAVDSHRKAASA 220

  Fly   189 QKKGYFDKEIVPVEIK-------DRKGTTTFSKDEYIKAGSTVEGIQKLRAAFKEGGSITAGNAS 246
            ...|.|..||.||:.|       |.| ..|.|.|:.|:..:|:.|:.||:..|||.|:.||||:|
plant   221 TASGKFKDEITPVKTKIVDPKTGDEK-PITVSVDDGIRPNTTLSGLAKLKPVFKEDGTTTAGNSS 284

  Fly   247 GVNDSAAAVLLMSGEEVARKGLKPLARIVGWTQSGIEPKVMGLGPVTAVEALLQKINWKREEVDL 311
            .::|.|.|||||......:|||..|.....::..|::|.:||:||..|:.|.::....:..:|||
plant   285 QLSDGAGAVLLMRRNVAMQKGLPILGVFRTFSAVGVDPAIMGVGPAVAIPAAVKAAGLELNDVDL 349

  Fly   312 YELNEAFAAQSLAVLQDLQLDAQKVNVNGGAIALGHPIGASGARVLVTLLYALERTGG--RKGIA 374
            :|:|||||:|.:.....|.|||:|:||||||||:|||:||:|||.:.|||:.::|.|.  |.|:.
plant   350 FEINEAFASQFVYCRNKLGLDAEKINVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVV 414

  Fly   375 SLCIGGGMGIALAVER 390
            |:|||.|||.|...||
plant   415 SMCIGSGMGAAAVFER 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9149NP_612094.2 PRK05790 1..391 CDD:180261 162/406 (40%)
thiolase 5..390 CDD:238383 158/402 (39%)
PKT4NP_171965.1 PLN02287 1..443 CDD:215161 162/406 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 126 1.000 Domainoid score I1771
eggNOG 1 0.900 - - E1_COG0183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1129049at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1088
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.