DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9149 and KAT5

DIOPT Version :9

Sequence 1:NP_612094.2 Gene:CG9149 / 38147 FlyBaseID:FBgn0035203 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001032037.1 Gene:KAT5 / 834946 AraportID:AT5G48880 Length:457 Species:Arabidopsis thaliana


Alignment Length:405 Identity:158/405 - (39%)
Similarity:223/405 - (55%) Gaps:32/405 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DVFIVSAARTPI-----GSFNGTLSKLKASDLGSVVIQEVLRRANVEGQEVNEVILGQALSAG-Q 61
            |:.||:|.||.|     |.|..||    ..||.:.|::.|:.|.:::..||.::::|..::.| |
plant    50 DIVIVAAYRTAICKARRGGFKDTL----PDDLLASVLKAVVERTSLDPSEVGDIVVGTVIAPGSQ 110

  Fly    62 GQNPARQASLKAGLPIQVPAYGINMLCGSGLKTVALGYQAIRSGDAQIVVAGGQESMSLAPHVMH 126
            .....|.|:..||.|..||...:|..|.|||:.||....:||:|...|.:..|.||||    ..|
plant   111 RAMECRVAAYFAGFPDSVPVRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGVESMS----TDH 171

  Fly   127 LRQGVKMG--PGTMVDSMIHDGLTDAMENIHMGITAENLADKYNISREAQDAYAVLSQNRAEEAQ 189
            :..|...|  |.........|.|      :.||||:||:|:::.::||.||..||.|..||..|.
plant   172 IPGGGFHGSNPRAQDFPKARDCL------LPMGITSENVAERFGVTREEQDMAAVESHKRAAAAI 230

  Fly   190 KKGYFDKEIVPV-------EIKDRKGTTTFSKDEYIKAGSTVEGIQKLRAAFKEGGSITAGNASG 247
            ..|....||:||       |.|..|.... |.|:.::..|.:..:.||:..||:.||.||||||.
plant   231 ASGKLKDEIIPVATKIVDPETKAEKAIVV-SVDDGVRPNSNMADLAKLKTVFKQNGSTTAGNASQ 294

  Fly   248 VNDSAAAVLLMSGEEVARKGLKPLARIVGWTQSGIEPKVMGLGPVTAVEALLQKINWKREEVDLY 312
            ::|.|.|||||......:|||..|.....:..:|:||.|||:||..|:.|..:.......::||:
plant   295 ISDGAGAVLLMKRSLAMKKGLPILGVFRSFAVTGVEPSVMGIGPAVAIPAATKLAGLNVSDIDLF 359

  Fly   313 ELNEAFAAQSLAVLQDLQLDAQKVNVNGGAIALGHPIGASGARVLVTLLYALERTGG--RKGIAS 375
            |:|||||:|.:...:.|:||.:||||||||||:|||:||:|||.:.|||:.::|.|.  |.|:.|
plant   360 EINEAFASQYVYSCKKLELDMEKVNVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVIS 424

  Fly   376 LCIGGGMGIALAVER 390
            :|||.|||.|...||
plant   425 MCIGTGMGAAAVFER 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9149NP_612094.2 PRK05790 1..391 CDD:180261 158/405 (39%)
thiolase 5..390 CDD:238383 155/401 (39%)
KAT5NP_001032037.1 PLN02287 1..457 CDD:215161 158/405 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 126 1.000 Domainoid score I1771
eggNOG 1 0.900 - - E1_COG0183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1129049at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1088
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.