DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9149 and ACAT2

DIOPT Version :9

Sequence 1:NP_612094.2 Gene:CG9149 / 38147 FlyBaseID:FBgn0035203 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_568694.2 Gene:ACAT2 / 834876 AraportID:AT5G48230 Length:403 Species:Arabidopsis thaliana


Alignment Length:393 Identity:179/393 - (45%)
Similarity:248/393 - (63%) Gaps:5/393 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DVFIVSAARTPIGSFNGTLSKLKASDLGSVVIQEVLRRANVEGQEVNEVILGQALSAGQGQNPAR 67
            ||.||..||||:|.|.|:||.|.|:.|||:.|...|:||||:...|.||:.|..|||..||.|||
plant    12 DVCIVGVARTPMGGFLGSLSSLPATKLGSLAIAAALKRANVDPALVQEVVFGNVLSANLGQAPAR 76

  Fly    68 QASLKAGLPIQVPAYGINMLCGSGLKTVALGYQAIRSGDAQIVVAGGQESMSLAP-HVMHLRQGV 131
            ||:|.||:|..|....:|.:|.||:|.|.:..|:|:.|...:|||||.||||..| ::...|:|.
plant    77 QAALGAGIPNSVICTTVNKVCASGMKAVMIAAQSIQLGINDVVVAGGMESMSNTPKYLAEARKGS 141

  Fly   132 KMGPGTMVDSMIHDGLTDAMENIHMGITAENLADKYNISREAQDAYAVLSQNRAEEAQKKGYFDK 196
            :.|..::||.|:.|||.|...:..||..||..|:|:.|:||.||.|||.|..|...||:.|.|..
plant   142 RFGHDSLVDGMLKDGLWDVYNDCGMGSCAELCAEKFQITREQQDDYAVQSFERGIAAQEAGAFTW 206

  Fly   197 EIVPVEIKDRKG--TTTFSKDEYIKAGSTVEGIQKLRAAFKE-GGSITAGNASGVNDSAAAVLLM 258
            ||||||:...:|  :|...|||.:......: ::|||.:||| ||::||||||.::|.|||::|:
plant   207 EIVPVEVSGGRGRPSTIVDKDEGLGKFDAAK-LRKLRPSFKENGGTVTAGNASSISDGAAALVLV 270

  Fly   259 SGEEVARKGLKPLARIVGWTQSGIEPKVMGLGPVTAVEALLQKINWKREEVDLYELNEAFAAQSL 323
            |||:..:.||..||:|.|:..:..||:.....|..|:...:.....:..:||.||:|||||..:|
plant   271 SGEKALQLGLLVLAKIKGYGDAAQEPEFFTTAPALAIPKAIAHAGLESSQVDYYEINEAFAVVAL 335

  Fly   324 AVLQDLQLDAQKVNVNGGAIALGHPIGASGARVLVTLLYALERTGGRKGIASLCIGGGMGIALAV 388
            |..:.|.:..:||||||||::||||:|.||||:|:|||..|::..|:.|:..:|.|||...||.:
plant   336 ANQKLLGIAPEKVNVNGGAVSLGHPLGCSGARILITLLGILKKRNGKYGVGGVCNGGGGASALVL 400

  Fly   389 ERL 391
            |.|
plant   401 ELL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9149NP_612094.2 PRK05790 1..391 CDD:180261 178/391 (46%)
thiolase 5..390 CDD:238383 175/388 (45%)
ACAT2NP_568694.2 PLN02644 11..403 CDD:215347 178/391 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60894
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000432
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100472
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.680

Return to query results.
Submit another query.