DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9149 and PKT3

DIOPT Version :9

Sequence 1:NP_612094.2 Gene:CG9149 / 38147 FlyBaseID:FBgn0035203 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_180873.1 Gene:PKT3 / 817876 AraportID:AT2G33150 Length:462 Species:Arabidopsis thaliana


Alignment Length:403 Identity:150/403 - (37%)
Similarity:227/403 - (56%) Gaps:30/403 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DVFIVSAARTPI-----GSFNGTLSKLKASDLGSVVIQEVLRRANVEGQEVNEVILGQALSAG-Q 61
            ||.||:|.|||:     |:|..|.    ..||.:.|::.::.:.|:...||.::::|..|:.| |
plant    51 DVVIVAAHRTPLCKSKRGNFKDTY----PDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQ 111

  Fly    62 GQNPARQASLKAGLPIQVPAYGINMLCGSGLKTVALGYQAIRSGDAQIVVAGGQESMSLAPHVMH 126
            ..:..|.|:..||.|..|....:|..|.|||:.||....||::|...|.:..|.|||:..|... 
plant   112 RASECRMAAFYAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAW- 175

  Fly   127 LRQGVKMGPGTMVDSMIHDGLTDAMENIHMGITAENLADKYNISREAQDAYAVLSQNRAEEAQKK 191
              :| .:.|.....:...:.|      :.||:|:||:|.::.:||:.||..||.|..:|..|...
plant   176 --EG-SVNPAVKKFAQAQNCL------LPMGVTSENVAQRFGVSRQEQDQAAVDSHRKAAAATAA 231

  Fly   192 GYFDKEIVPVEIK-------DRKGTTTFSKDEYIKAGSTVEGIQKLRAAFKEGGSITAGNASGVN 249
            |.|..||:||:.|       |.| ..|.|.|:.|:..:|:..:.||:..||:.|:.||||:|.|:
plant   232 GKFKDEIIPVKTKLVDPKTGDEK-PITVSVDDGIRPTTTLASLGKLKPVFKKDGTTTAGNSSQVS 295

  Fly   250 DSAAAVLLMSGEEVARKGLKPLARIVGWTQSGIEPKVMGLGPVTAVEALLQKINWKREEVDLYEL 314
            |.|.|||||......:|||..|.....:...|::|.:||:||..|:.|.::....:.:::||:|:
plant   296 DGAGAVLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEI 360

  Fly   315 NEAFAAQSLAVLQDLQLDAQKVNVNGGAIALGHPIGASGARVLVTLLYALERTGG--RKGIASLC 377
            |||||:|.:.....|.||.:|:||||||:|:|||:||:|||.:.|||:.::|.|.  |.|:.|:|
plant   361 NEAFASQFVYCRNKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMC 425

  Fly   378 IGGGMGIALAVER 390
            ||.|||.|...||
plant   426 IGTGMGAAAVFER 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9149NP_612094.2 PRK05790 1..391 CDD:180261 150/403 (37%)
thiolase 5..390 CDD:238383 146/399 (37%)
PKT3NP_180873.1 PLN02287 1..456 CDD:215161 150/403 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 126 1.000 Domainoid score I1771
eggNOG 1 0.900 - - E1_COG0183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1129049at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1088
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.