DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9149 and acaa1

DIOPT Version :9

Sequence 1:NP_612094.2 Gene:CG9149 / 38147 FlyBaseID:FBgn0035203 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001072686.1 Gene:acaa1 / 780143 XenbaseID:XB-GENE-963068 Length:419 Species:Xenopus tropicalis


Alignment Length:404 Identity:167/404 - (41%)
Similarity:232/404 - (57%) Gaps:37/404 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DVFIVSAARTPI-----GSFNGTLSKLKASDLGSVVIQEVLRRANVEGQEVNEVILGQALSAGQG 62
            |:.||:..||||     |.|..|    ...:|.|.|:..||...|:..:.:.::.:|..|..|.|
 Frog    32 DIVIVAGRRTPICKAKRGGFKET----TPDELLSAVMTAVLNDVNLNPELLGDICVGNVLQPGAG 92

  Fly    63 QNPARQASLKAGLPIQVPAYGINMLCGSGLKTVALGYQAIRSGDAQIVVAGGQESMSLAPHVMHL 127
            ...||.....:|:|..||.:.:|..|.|||:.:......||:|...:.:|.|.|||||.      
 Frog    93 ALVARIGQFLSGIPESVPLHVVNRQCSSGLQAIINIAGGIRNGSYDVGLACGVESMSLR------ 151

  Fly   128 RQGVKMG-PG-----TMVDSMIHDGLTDAMENIHMGITAENLADKYNISREAQDAYAVLSQNRAE 186
                .:| ||     ||..|...|.|      |.||||:||:|:::.|:||.||:.|:.||.||.
 Frog   152 ----SVGNPGDISSRTMDFSKARDCL------IPMGITSENVAERFGITREKQDSLALASQQRAA 206

  Fly   187 EAQKKGYFDKEIVPV--EIKDRKGTT---TFSKDEYIKAGSTVEGIQKLRAAFKEGGSITAGNAS 246
            .||:.|.|.:||||:  ...|.:|.|   |.::||.|:|.:|:||:.:|:||||||||.||||:|
 Frog   207 AAQRSGRFKEEIVPITTTFTDDQGNTKTITVTEDEGIRASTTMEGLGRLKAAFKEGGSTTAGNSS 271

  Fly   247 GVNDSAAAVLLMSGEEVARKGLKPLARIVGWTQSGIEPKVMGLGPVTAVEALLQKINWKREEVDL 311
            .|:|.|||||:....:..:.||..|..:..:...|:.|.|||:||..|:.|.|||......::|:
 Frog   272 QVSDGAAAVLMAKRCKAEQLGLPILGVLRSFAVVGVPPDVMGIGPAYAIPAALQKAGLSVHDIDV 336

  Fly   312 YELNEAFAAQSLAVLQDLQLDAQKVNVNGGAIALGHPIGASGARVLVTLLYALERTGGRK-GIAS 375
            ||:|||||:|:...::.|.:..:|||.||||||||||:|.:|||..||||..|:|.|.|. |:.|
 Frog   337 YEINEAFASQAAYCVEKLGIPLEKVNPNGGAIALGHPLGCTGARQTVTLLNELKRRGKRGFGVVS 401

  Fly   376 LCIGGGMGIALAVE 389
            :|||.|||.|...|
 Frog   402 MCIGTGMGAAAVYE 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9149NP_612094.2 PRK05790 1..391 CDD:180261 167/404 (41%)
thiolase 5..390 CDD:238383 166/402 (41%)
acaa1NP_001072686.1 Thiolase_N 1..415 CDD:332572 166/402 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1129049at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.