DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9149 and hadhb

DIOPT Version :9

Sequence 1:NP_612094.2 Gene:CG9149 / 38147 FlyBaseID:FBgn0035203 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_989142.1 Gene:hadhb / 394747 XenbaseID:XB-GENE-1009673 Length:470 Species:Xenopus tropicalis


Alignment Length:425 Identity:136/425 - (32%)
Similarity:216/425 - (50%) Gaps:41/425 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDVFIVSAARTPIGSFNGTLSKLKASDLGSVVIQEVLRRANVEGQEVNEVILGQALSAGQGQNP 65
            :.:|.||...|||......|.:.|...||....:|.:|:|.||..:.|:.::.|..:...:..|.
 Frog    47 VKNVVIVDGVRTPFLLSGTTYADLMPHDLARTALQGLLQRTNVPREVVDYIVYGTVIQEVKTSNV 111

  Fly    66 ARQASLKAGLPIQVPAYGINMLCGSGLKTVALGYQAIRSGDAQIVVAGGQESMSLAP--H----- 123
            ||:|:|.||...:.||:.:.|.|.|..:.:..|...|.||...:|||||.|.||..|  |     
 Frog   112 AREAALGAGFSDKTPAHTVTMACISSNQAMTTGVGLIASGQCDVVVAGGVEFMSDVPIRHSRKMR 176

  Fly   124 --VMHLRQGVKMGPGTMVDSMIH--------DGLTDAMENIHMGITAENLADKYNISREAQDAYA 178
              ::.|.:...:|....|.|.|.        ..:.:...:..||.:|:.||..:::||..||.||
 Frog   177 KTMLSLNKAKTLGQRLSVISGIRPNYFAPELPAVAEFSTSETMGHSADRLAAAFSVSRVEQDEYA 241

  Fly   179 VLSQNRAEEAQKKGYFDKEIVPVEIKDRKGTTTFSKDEYIKAGSTVEGIQKLRAAF-KEGGSITA 242
            :.|...|::||..|.. .:::|.::   .|..|..||..|:. |::|.:.||:.|| |..||:||
 Frog   242 LRSHTLAKKAQDAGLL-SDVIPYKV---PGKQTVDKDNGIRP-SSMEQMAKLKPAFIKPHGSVTA 301

  Fly   243 GNASGVNDSAAAVLLMSGEEVARKGLKPLARIVGWTQSGIEPK-VMGLGPVTAVEALLQKINWKR 306
            .|:|.:.|.|:|||:||.|:....|.||.|.:..:.....:|| .:.|||..|...:|::.....
 Frog   302 ANSSFLTDGASAVLIMSEEKALAMGYKPKAYLRDFVYVSQDPKDQLLLGPTYATPKVLERAGLTL 366

  Fly   307 EEVDLYELNEAFAAQSLAVLQDLQLD--AQ---------------KVNVNGGAIALGHPIGASGA 354
            .::|.:|.:||||.|.|:.|:.:..|  ||               |.|:.||:::||||.||:|.
 Frog   367 ADIDAFEFHEAFAGQILSNLKAMDSDWFAQNYMGRKAKVGAPALDKFNMWGGSLSLGHPFGATGC 431

  Fly   355 RVLVTLLYALERTGGRKGIASLCIGGGMGIALAVE 389
            |:::...:.|::.||:.|:.:.|..||.|..:.||
 Frog   432 RLVMAAAHRLKKDGGQYGLVAACAAGGQGHGMIVE 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9149NP_612094.2 PRK05790 1..391 CDD:180261 136/425 (32%)
thiolase 5..390 CDD:238383 135/421 (32%)
hadhbNP_989142.1 thiolase 51..466 CDD:238383 133/419 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1129049at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.