DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9149 and ACAT1

DIOPT Version :9

Sequence 1:NP_612094.2 Gene:CG9149 / 38147 FlyBaseID:FBgn0035203 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001373606.1 Gene:ACAT1 / 38 HGNCID:93 Length:434 Species:Homo sapiens


Alignment Length:401 Identity:170/401 - (42%)
Similarity:247/401 - (61%) Gaps:15/401 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDVFIVSAARTPIGSFNGTLSKLKASDLGSVVIQEVLRRANVEGQEVNEVILGQALSAGQGQNP 65
            :.:|.||||.|||||||.|:||.|.|:.|||:.||..:.:|.:..:||.|..:|..|..|:||.|
Human    39 LKEVVIVSATRTPIGSFLGSLSLLPATKLGSIAIQGAIEKAGIPKEEVKEAYMGNVLQGGEGQAP 103

  Fly    66 ARQASLKAGLPIQVPAYGINMLCGSGLKTVALGYQAIRSGDAQIVVAGGQESMSLAPHVMHLRQG 130
            .|||.|.|||||..|...||.:|.||:|.:.:..|::..|...::||||.||||..|:||: |..
Human   104 TRQAVLGAGLPISTPCTTINKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVPYVMN-RGS 167

  Fly   131 VKMGPGTMVDSMIHDGLTDAMENIHMGITAENLADKYNISREAQDAYAVLSQNRAEEAQKKGYFD 195
            ...|...:.|.::.|||||....||||..|||.|.|.||:|..|||||:.|..|::.|.:.|.|.
Human   168 TPYGGVKLEDLIVKDGLTDVYNKIHMGSCAENTAKKLNIARNEQDAYAINSYTRSKAAWEAGKFG 232

  Fly   196 KEIVP--VEIKDRKGTTTFSKDEYIKAGSTVEGIQKLRAAF-KEGGSITAGNASGVNDSAAAVLL 257
            .|::|  |.:|.:........:||.:.  ....:.||:..| ||.|::||.|||.:||.|||::|
Human   233 NEVIPVTVTVKGQPDVVVKEDEEYKRV--DFSKVPKLKTVFQKENGTVTAANASTLNDGAAALVL 295

  Fly   258 MSGEEVARKGLKPLARIVGWTQSGIEPKVMGLGPVTAVEALLQKINWKREEVDLYELNEAFAAQS 322
            |:.:...|..:.||||||.:..:.:||....:.||.|...:|:.:..|:|::.::|:||||:...
Human   296 MTADAAKRLNVTPLARIVAFADAAVEPIDFPIAPVYAASMVLKDVGLKKEDIAMWEVNEAFSLVV 360

  Fly   323 LAVLQDLQLDAQKVNVNGGAIALGHPIG-------ASGARVLVTLLYALERTGGRKGIASLCIGG 380
            ||.::.|::|.||||:||||::||||||       .||||::..|.:||::  |..|:||:|.||
Human   361 LANIKMLEIDPQKVNINGGAVSLGHPIGKCFLNFRMSGARIVGHLTHALKQ--GEYGLASICNGG 423

  Fly   381 GMGIALAVERL 391
            |...|:.:::|
Human   424 GGASAMLIQKL 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9149NP_612094.2 PRK05790 1..391 CDD:180261 169/399 (42%)
thiolase 5..390 CDD:238383 168/394 (43%)
ACAT1NP_001373606.1 thiolase 43..433 CDD:238383 168/394 (43%)
Coenzyme A binding. /evidence=ECO:0000269|PubMed:17371050 258..260 0/3 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60894
OrthoDB 1 1.010 - - D321628at33208
OrthoFinder 1 1.000 - - FOG0000432
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100472
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.